KEGG   Haemophilus somnus 2336: HSM_1786Help
Entry
HSM_1786          CDS       T00673                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
hsm  Haemophilus somnus 2336
Pathway
hsm00010  Glycolysis / Gluconeogenesis
hsm00030  Pentose phosphate pathway
hsm00051  Fructose and mannose metabolism
hsm00052  Galactose metabolism
hsm00680  Methane metabolism
hsm01100  Metabolic pathways
hsm01110  Biosynthesis of secondary metabolites
hsm01120  Microbial metabolism in diverse environments
hsm01130  Biosynthesis of antibiotics
hsm01200  Carbon metabolism
hsm01230  Biosynthesis of amino acids
hsm03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:hsm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HSM_1786
   00030 Pentose phosphate pathway
    HSM_1786
   00051 Fructose and mannose metabolism
    HSM_1786
   00052 Galactose metabolism
    HSM_1786
  Energy metabolism
   00680 Methane metabolism
    HSM_1786
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    HSM_1786
Enzymes [BR:hsm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     HSM_1786
Protein phosphatases and associated proteins [BR:hsm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     HSM_1786
Messenger RNA biogenesis [BR:hsm03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     HSM_1786
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ACA31569
JGI: HSM1786
UniProt: B0UW05
Position
complement(2030648..2031613)
Genome map
AA seq 321 aa AA seqDB search
MIKKIAVLTSGGDAPGMNAAIRGVVRSALSEGLEVYGIYEGYYGLYHNKIQQLTRYSVSD
IINRGGTFLGSARFPEFKDPAVREKCVEILRSHGIDALVVIGGDGSYMGAKLLTEEHDFP
CVGIPGTIDNDVAGTDYTIGYQTALETAVEAIDRLRDTSSSHKRISIVEIMGRHCSDLTI
SAAIAGGCEYIVASEIEFNREELIKQIERAIIKGKRHAIIAITELLCDVNELAREIEARV
KHETRATILGHIQRGGTPCAFDRILGSRMGVYAVDLLLQGKGGYCVGIQNEQLVHHDIID
AINNMRREFKADWLAMSKRLD
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaaaaattgcagttttaacaagtggcggtgatgcaccggggatgaatgctgcg
atacgtggtgttgttcgttcggctttatccgagggtttggaagtttatgggatttatgaa
ggttattacggtttatatcacaacaagatccaacaattaactcgctatagcgtatcggat
attatcaaccggggcggtacattcctcggctcagctcgtttccctgagtttaaagatcct
gccgtacgtgaaaaatgcgtggaaattttacgttcacatggtattgatgcactggtcgtc
atcgggggagacggttcttatatgggagcaaaattactcactgaagaacatgatttccct
tgtgtcggtattcctggaacaattgataatgatgttgctggcactgattatactatcggt
tatcaaaccgcacttgaaaccgcagttgaggcaattgaccgtttacgtgatacctcaagt
tcacacaagcgtatttctatcgtggaaattatgggcagacattgtagcgatttgacgatc
tcggcggctattgcaggtggttgtgaatatattgttgcttctgaaattgaatttaatcgt
gaagaattaattaagcaaattgagcgtgccattattaagggtaagcgtcatgcaattatt
gccatcactgaattattatgtgatgtgaatgagctggctcgagaaattgaagcccgtgta
aaacacgaaactcgagcaactattttaggccatattcaacgtggcggtacgccttgtgct
tttgaccgcattttaggttctcgtatgggggtttacgctgtagatcttttattacagggc
aaaggtggttattgtgtcggtatccaaaatgaacaattggtgcatcatgatattattgat
gcaattaataatatgcgtcgtgaatttaaagccgattggttagctatgtctaaacggtta
gattga

DBGET integrated database retrieval system