KEGG   Haemophilus somnus 2336: HSM_1786Help
Entry
HSM_1786          CDS       T00673                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
hsm  Haemophilus somnus 2336
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hsm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HSM_1786
   01230 Biosynthesis of amino acids
    HSM_1786
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HSM_1786
   00030 Pentose phosphate pathway
    HSM_1786
   00051 Fructose and mannose metabolism
    HSM_1786
   00052 Galactose metabolism
    HSM_1786
  Energy metabolism
   00680 Methane metabolism
    HSM_1786
Enzymes [BR:hsm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     HSM_1786
Protein phosphatases and associated proteins [BR:hsm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     HSM_1786
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2030648..2031613)
Genome map
AA seq 321 aa AA seqDB search
MIKKIAVLTSGGDAPGMNAAIRGVVRSALSEGLEVYGIYEGYYGLYHNKIQQLTRYSVSD
IINRGGTFLGSARFPEFKDPAVREKCVEILRSHGIDALVVIGGDGSYMGAKLLTEEHDFP
CVGIPGTIDNDVAGTDYTIGYQTALETAVEAIDRLRDTSSSHKRISIVEIMGRHCSDLTI
SAAIAGGCEYIVASEIEFNREELIKQIERAIIKGKRHAIIAITELLCDVNELAREIEARV
KHETRATILGHIQRGGTPCAFDRILGSRMGVYAVDLLLQGKGGYCVGIQNEQLVHHDIID
AINNMRREFKADWLAMSKRLD
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaaaaattgcagttttaacaagtggcggtgatgcaccggggatgaatgctgcg
atacgtggtgttgttcgttcggctttatccgagggtttggaagtttatgggatttatgaa
ggttattacggtttatatcacaacaagatccaacaattaactcgctatagcgtatcggat
attatcaaccggggcggtacattcctcggctcagctcgtttccctgagtttaaagatcct
gccgtacgtgaaaaatgcgtggaaattttacgttcacatggtattgatgcactggtcgtc
atcgggggagacggttcttatatgggagcaaaattactcactgaagaacatgatttccct
tgtgtcggtattcctggaacaattgataatgatgttgctggcactgattatactatcggt
tatcaaaccgcacttgaaaccgcagttgaggcaattgaccgtttacgtgatacctcaagt
tcacacaagcgtatttctatcgtggaaattatgggcagacattgtagcgatttgacgatc
tcggcggctattgcaggtggttgtgaatatattgttgcttctgaaattgaatttaatcgt
gaagaattaattaagcaaattgagcgtgccattattaagggtaagcgtcatgcaattatt
gccatcactgaattattatgtgatgtgaatgagctggctcgagaaattgaagcccgtgta
aaacacgaaactcgagcaactattttaggccatattcaacgtggcggtacgccttgtgct
tttgaccgcattttaggttctcgtatgggggtttacgctgtagatcttttattacagggc
aaaggtggttattgtgtcggtatccaaaatgaacaattggtgcatcatgatattattgat
gcaattaataatatgcgtcgtgaatttaaagccgattggttagctatgtctaaacggtta
gattga

DBGET integrated database retrieval system