KEGG   Haemophilus somnus 2336: HSM_1812Help
Entry
HSM_1812          CDS       T00673                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
hsm  Haemophilus somnus 2336
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hsm00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    HSM_1812
Enzymes [BR:hsm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     HSM_1812
Transfer RNA biogenesis [BR:hsm03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    HSM_1812
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2063079..2063897
Genome map
AA seq 272 aa AA seqDB search
MNELKSQVLLEKVLQIAHQAGDYLNLFYNGEFDFQINIKSDNTPITNADLFVNQFLIEKL
TALTPHIPVLSEESCQISFSDRRRWRTYWLIDPLDGTQQFINRTDQFAVLIALIHQNRIM
LGIIHAPVLKQTYYALKGHGAYKQTEHSLQTLSARKFDLNHTVKIAVGSKNAEQKVRSIL
RSNYQYEFITYGSSGLKTALVAEGSADCYIRLGQTGEWDTAAAEAILSEIGGGIRDTQFN
ALTYNKRPSLINPDFIMVSDISADWKKIFQFN
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaattaaaaagtcaggtactgctggaaaaggttttacaaatcgctcatcaagct
ggagactatcttaatcttttttacaatggagaatttgattttcagatcaacataaaatcg
gataatacgcctatcacaaacgcagatttatttgtaaaccagtttcttatcgaaaaactg
accgcacttacgccacatatccctgttttatcagaagaaagctgtcaaatttctttttca
gatcgacggcggtggcgtacttattggttgattgatccgctggatggtacacaacaattt
attaatcgaacagatcaattcgctgtgctaattgcactgattcatcaaaatcggatcatg
ttaggtattattcatgctcccgtgttaaaacaaacttattatgccctgaaagggcatggt
gcttataaacaaacggaacattctctgcaaactttatcagccagaaaatttgacttaaac
catacagtaaaaattgcagtaggttcaaaaaatgcggagcaaaaagtgcggtcaattttg
agatcaaattatcaatacgaatttattacttatggttctagcggtttaaaaaccgcactg
gttgcagaaggaagtgcagattgctatattcgactgggacaaaccggtgaatgggacaca
gctgcggcggaagccattttatccgaaataggcggaggaatccgtgatacccaattcaac
gccctaacttataacaaacgaccgagtttaataaaccctgattttattatggtatcggac
atatctgccgattggaaaaaaatctttcaatttaattaa

DBGET integrated database retrieval system