KEGG   Haemophilus somnus 129PT: HS_0045Help
Entry
HS_0045           CDS       T00386                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
hso  Haemophilus somnus 129PT
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:hso00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
48677..49345
Genome map
AA seq 222 aa AA seqDB search
MALHLPLISIIAGQELNRLPNKLQQLNCGDYVVAVSKNAVEYAQKTLSAVGFCWRSDLYY
FTVGQRTAEYFASQIENSVYYPVEQESSEGLLNLPQMQDLQARNILILRANGGREFFTEQ
AILRGAKVETLECYQRMPIEYNKLEKISLCQRIGVDTIVVTSQEMLNYLVKLVPTNETGW
LFSCRLVTVSQRIAALAKSVGWTNIVVADKADNLSLFLALQQ
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggcactccatttaccgcttatttccattatagcggggcaagaattaaatcgattaccc
aataaattacaacaattaaattgtggtgattatgtagttgcagtatctaaaaatgcggtg
gaatatgcacaaaaaaccttaagtgcggtaggtttttgttggcgttcggacttatattac
tttacggttggacaacgaactgcagaatattttgcgagccaaatagaaaattcggtgtat
tatcctgttgagcaagaaagtagtgaaggattacttaatttacctcaaatgcaagacctt
caggcaaggaatattttgattttgagagcgaatggaggacgggaattttttactgagcag
gctattttgcgaggagctaaagttgaaactctggaatgttatcaacgaatgcccattgaa
tataataagttggaaaaaattagtttatgccaacgtattggggtagataccattgttgta
acaagtcaagagatgttaaattacttagtgaaacttgtgccaaccaatgaaacaggctgg
ttattcagttgtcgtttggtaacggtaagtcaacgtatagcggcattggcaaaaagtgtt
gggtggacaaatattgttgtggcagataaagcggataacttgagtcttttccttgcattg
caacaatga

DBGET integrated database retrieval system