KEGG   Haemophilus somnus 129PT: HS_0192Help
Entry
HS_0192           CDS       T00386                                 

Gene name
proB
Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
hso  Haemophilus somnus 129PT
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hso01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:hso00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
173358..174470
Genome map
AA seq 370 aa AA seqDB search
METQKTNKTIVVKFGTSTLTQGSSKLNRPHMMEIVRQITQLHRAGFRIIIVTSGAMAAGR
HYLNHPQLPPTIASKQLLAAVGQSQLIQTWEQLFAIYDIHIGQILLTRADIEDRERFMNA
RDTLHALLDNRIIPVINENDAVATAEIKVGDNDNLSALVAILAQAEQLYLLTDQRGLFDS
DPRKNPQAKLISIVDKITDHIRSIAGGSGTTLGTGGMTTKISAADIATRSGVETIIAPGN
LENVIVNLAYGKEIGTKFVVQTDCLESRKQWLFAAPVAGIVTIDEGAESAVLIQHKSLLP
AGIISVEGCFSRGEVVKICGTNGKKIALGVPRYNSDSLIQIKGKKSQDIEQILGYEYGSV
AIHRDDMVVY
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggaaacacaaaaaacaaataaaaccattgtggtaaaatttggtaccagcaccttaacg
caaggttcatcaaaattaaatcgccctcacatgatggaaattgtgcgtcaaatcacacag
ttgcatcgagcaggctttcgtataattattgttacctccggagcgatggcagcggggcga
cattatctcaatcatccgcaacttcctccaacaattgcctcaaagcaattactagcagca
gtaggacaaagtcaactcattcaaacgtgggaacaacttttcgctatttatgatattcat
attgggcaaattctgttaactcgagcggacattgaagatcgtgaacgttttatgaacgca
agagatacgttacatgctttattagataaccgaattattccggtaattaatgaaaatgat
gcggttgcaaccgctgaaattaaagtgggggataatgacaacctttctgcattagtggct
attttggcacaagcggaacaactctacttgctaacagatcaacgtggattatttgatagt
gatccaagaaaaaatcctcaagcaaaactgatttccatagtcgataaaattactgatcat
atccgctctattgcaggaggaagtgggacaacgttagggacgggaggaatgacaacaaaa
attagtgctgctgacatagcgactcgttccggtgttgaaaccattattgcaccgggtaat
cttgaaaatgtcatcgtcaatttggcttatgggaaagaaatcggcacaaaatttgttgtg
cagacagattgcttggaaagccgtaaacagtggctctttgctgcaccggttgcaggtata
gtaactattgatgagggagcggaaagtgcggtattgattcagcataaatctctattacct
gcaggtattatcagcgttgaaggatgtttttctcgtggtgaagttgttaaaatttgtggc
acgaacggtaaaaaaattgctttgggcgtacctcgctataacagcgattctctcatacaa
ataaaaggaaaaaaatcgcaagatattgaacagatcctcggttatgaatatggttctgtt
gctattcatcgtgatgatatggtcgtttattaa

DBGET integrated database retrieval system