KEGG   Haemophilus somnus 129PT: HS_0195Help
Entry
HS_0195           CDS       T00386                                 

Gene name
tufA
Definition
elongation factor Tu (EC:3.6.5.3)
Orthology
K02358  
elongation factor Tu
Organism
hso  Haemophilus somnus 129PT
Brite
Mitochondrial biogenesis [BR:hso03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    HS_0195 (tufA)
Exosome [BR:hso04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   HS_0195 (tufA)
  Exosomal proteins of breast cancer cells
   HS_0195 (tufA)
  Exosomal proteins of colorectal cancer cells
   HS_0195 (tufA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(175770..176954)
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLSKHFGGAARAFDQIDNAPEEKARG
ITINTSHVEYDTATRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGSALQALN
GVAEWEEKILELASHLDNYIPEPERAIDQPFLLPIEDVFSISGRGTVVTGRVERGIIRTG
EEVEIVGIKETTKTTVTGVEMFRKLLDEGRAGENIGALLRGTKREEIERGQVLAKPGSIT
PHTDFESEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMT
VSLIHPIAMDQGLRFAIREGGRTVGAGVVAKIIK
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaaatttgaacgtacaaaaccgcacgtaaacgtgggtacaatcggccac
gttgaccacggtaaaacaactttaacagcagcgatcacgactgtattatccaaacacttt
ggtggtgcagcacgtgcatttgaccaaattgataacgcaccggaagagaaagcacgtggt
atcactatcaacacttcacacgttgaatatgatacagcgacacgtcactacgcacacgtt
gactgtccgggacacgctgactatgtaaaaaatatgattacaggtgcggcacaaatggac
ggtgctattttagtggtagcggcaacagacggtccaatgccacaaactcgtgagcacatc
ttattaggtcgtcaggtgggtgtaccgtacatcatcgtattcttaaacaaatgcgacatg
gtagatgacgaagaattattggaattggttgagatggaagtacgtgaattactttctcaa
tacgacttcccgggcgatgacacaccaattgtacgtggttcagcattacaagcattaaat
ggagttgctgagtgggaagaaaaaattcttgaattagcatctcacttagacaactatatt
ccggagcctgagcgtgcgattgaccaaccgttcttattaccgattgaagatgttttctca
atttcaggacgtggtacagtagtaaccggacgtgtagagcgtggtattatccgtacgggt
gaagaagttgaaattgtcggtattaaagagacaacaaaaaccacggtaacgggtgtagaa
atgttccgtaaattattagacgaaggtcgtgcgggagaaaacattggagcgttattacgt
ggaacaaaacgtgaagaaattgaacgtggtcaagtattagcgaaaccgggttcaattaca
ccgcacacagactttgaatcagaagtttatgtgttgtcaaaagaggaaggaggacgtcat
acaccattcttcaaaggttaccgtccacaattctatttccgtactactgacgtaactggt
acaattgaattaccggaaggtgttgaaatggtcatgcctggcgataacatcaaaatgaca
gtaagcttaattcacccgattgcgatggaccaagggttacgttttgcgattcgtgaaggt
ggacgtactgtaggtgcgggtgttgttgctaagattattaagtaa

DBGET integrated database retrieval system