KEGG   Haemophilus somnus 129PT: HS_0269Help
Entry
HS_0269           CDS       T00386                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
hso  Haemophilus somnus 129PT
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:hso00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    HS_0269 (ruvA)
Enzymes [BR:hso01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     HS_0269 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
267444..268058
Genome map
AA seq 204 aa AA seqDB search
MIGRVTGILVEKQAPEILLDVQGVGYELLLPMTSFYNLPEVGQETTLFTHFVVREDAHLL
FGFSHKQDRSLFRELIKTNGVGPKLALAILSAMSVNEFVYAIEQEELSKLVKIPGVGKKT
AERLLVELKGKFKGLQQTDFFIKSSHLPGIKCSKLDQSLQLDEAVSALIALGYKPIEAEK
MVKKVLKADLTSEQLIREALKAAL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgattgggcgtgtaacaggaatactggttgaaaaacaagctccggaaattttactggat
gttcaaggtgttgggtatgagttacttttacccatgacaagtttttataatttgccggaa
gttgggcaggaaactacgttgtttacgcattttgtggtgcgtgaagatgctcatttgtta
tttggatttagccataaacaagaccgctctttatttcgtgaattgattaaaaccaatgga
gtcggaccaaaattagctttagctatcctgtctgcgatgtcagtgaatgaatttgtgtat
gcgattgaacaagaagaattatctaaattagtcaaaattcccggagtaggaaaaaaaact
gctgaacgtttattggtggagctaaaaggtaaatttaaaggcttacaacaaacagatttc
tttattaaaagctctcatttacctggaattaaatgctcaaaactggatcaaagtttgcag
ttggatgaagcagtttctgctttaattgcgttaggatataagcctattgaagcagagaaa
atggttaaaaaagtgttaaaagcagatttaactagtgaacagcttattcgagaggctttg
aaagccgcattataa

DBGET integrated database retrieval system