KEGG   Haemophilus somnus 129PT: HS_0410Help
Entry
HS_0410           CDS       T00386                                 

Gene name
tdk
Definition
thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
hso  Haemophilus somnus 129PT
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hso00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    HS_0410 (tdk)
Enzymes [BR:hso01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     HS_0410 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(436082..436669)
Genome map
AA seq 195 aa AA seqDB search
MAKLYFYYSTMNAGKSTTLLQSDYNYRERNMNTLVYTAAIDDRFGKGKVSSRIGIHRQAN
LFHKDTDLFTEIALHIKQQKLHCILIDEAQFLTKAQVYQLSNVVDELNIPVLCYGLRTDF
QAELFEGSKYLLAWADQLEELKTICYCGRKANFVLRLNEQGKAVKDGEQIQIGGNDSYMS
VCRKHYKEILYSSNE
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactatatttttattattccacgatgaatgcggggaaatctacaaccttatta
caatcggattataactatcgtgaacgtaacatgaatacgttagtttatacagctgccatc
gacgatcgttttggtaaaggtaaagtgagttcacgtattggcattcatagacaagcgaat
ttatttcataaagacactgatctttttactgaaatagcactgcatattaagcagcaaaaa
ttacattgtattttaattgatgaagctcagtttttaacgaaagcacaagtctatcaacta
agcaatgtggtagatgaactcaatattccggtattatgctatggtctgcgtacagatttc
caagcagaattattcgaaggaagcaaatatctgttggcttgggcagatcaacttgaagaa
ttgaaaactatttgttactgcggtcgtaaagctaattttgttttacgcttaaatgaacaa
ggtaaagcagtcaaagacggtgagcaaattcaaattggcggaaatgatagttatatgtcg
gtatgccgtaaacattataaagaaatactttattcttctaatgaataa

DBGET integrated database retrieval system