KEGG   Haemophilus somnus 129PT: HS_0490Help
Entry
HS_0490           CDS       T00386                                 

Gene name
holD
Definition
DNA polymerase III subunit psi (EC:2.7.7.7)
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
hso  Haemophilus somnus 129PT
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:hso00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    HS_0490 (holD)
   00240 Pyrimidine metabolism
    HS_0490 (holD)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    HS_0490 (holD)
   03430 Mismatch repair
    HS_0490 (holD)
   03440 Homologous recombination
    HS_0490 (holD)
Enzymes [BR:hso01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     HS_0490 (holD)
DNA replication proteins [BR:hso03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     HS_0490 (holD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
532146..532550
Genome map
AA seq 134 aa AA seqDB search
MNRRDKLLQEMGISQWQLRHPEILKGLVNVSVAKNIRLIMISEQPVLKEQPFLQDIFRSL
ELMKEDCLCIDFDFLPYLQVEHEVIYWLLTNDQQKIDRTLSDKQYMPCWKSNELERLKQS
PQEKRQFWQQIQEI
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgaacagacgagataaactcttacaagaaatgggtatttcacagtggcaattacgccat
cccgagattttaaaagggttggtaaatgtctctgtggcaaaaaatattcgtttgattatg
atttctgaacagccggttttaaaagaacaaccgtttttacaagatatttttcgtagtctt
gagctaatgaaagaagattgtttatgtattgactttgattttttgccttatcttcaagtc
gaacatgaagtaatttattggttactcacaaacgatcaacagaaaatagaccgcacttta
agcgataagcaatatatgccttgttggaaaagtaatgagcttgagagattaaagcaaagt
cctcaggaaaaacgtcagttttggcagcaaattcaggaaatatag

DBGET integrated database retrieval system