KEGG   Haemophilus somnus 129PT: HS_0578Help
Entry
HS_0578           CDS       T00386                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
hso  Haemophilus somnus 129PT
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hso01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:hso00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
613409..614542
Genome map
AA seq 377 aa AA seqDB search
MKNNIITLTQSLIQRPSISPDDQGCQQLIAERLQAVGFKLEWLPFGDTLNLWATHGEGKC
IAFAGHTDVVPIGNESQWTYLPFEARIVENMLYGRGAADMKGALAAMVIAAETFVKHLPN
HQGKIALLITSDEEAAATNGTVKVVETLIKRNEKIDYCVVGEPSSATQFGDIIKNGRRGS
ITGNLYIQGVQGHVAYPHLADNPVHNALKFLDELTHYQWDKGNEFFPPTSLQIANIHAGT
GSNNVIPGELYVQFNLRYCTEVTDEIIKTKVTEMLEKHKLTYRIDWNLSGKPFLTPQGKL
VNATLEAVEKFTQIRPHLDTGGGTSDARFIATMGAEVVEFGPLNQTIHKVNECVNIDDLA
KCGEIYYHILEKLFNEQ
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaataacataattactctcactcaaagtcttattcaacgtccttcaattagccct
gatgatcaaggctgtcaacaacttattgccgaacgtttacaagcggttggttttaagttg
gagtggttaccttttggtgataccttaaatttatgggccactcatggtgaaggaaaatgt
attgcttttgcggggcatacagacgttgttccgattggtaatgaaagtcaatggacttat
ctgccttttgaagcccgaattgttgaaaatatgctgtatgggcgtggtgctgcggatatg
aaaggtgctttggcagcaatggttattgcggcggaaacttttgtgaaacacctgccaaat
catcagggaaaaatagccttgttgattacctctgatgaagaggcagcggctaccaatgga
acggtaaaagtagtggaaacgctaataaaacgtaatgaaaagattgactattgtgtagta
ggtgaaccttccagtgcaacgcaatttggcgacattattaaaaacggacgacgtggttct
attacaggaaatttgtatattcaaggtgtacaaggtcatgtggcttatcctcatttagcg
gataatcctgttcataatgccttgaaattcttagatgaattaactcattatcaatgggat
aaaggtaatgaatttttcccgccgaccagtttacaaatcgccaatattcatgcagggaca
ggtagtaataatgtaatccccggtgaactttatgtgcaatttaacttgcgttattgtact
gaggtgacagatgaaattattaaaactaaagtgactgagatgttggaaaagcataaatta
acgtaccgtatagactggaatttatcgggcaaaccgtttttaacacctcaaggaaaatta
gtaaatgccacactggaagcagtagaaaaatttactcaaatcagaccgcacttagataca
ggcggtgggacttctgatgcccgttttattgccacaatgggagcggaagtcgtggagttt
ggacctcttaaccaaaccattcataaagtgaatgaatgcgtgaatattgatgatttagct
aagtgcggtgagatttattatcatattttggaaaaattgtttaatgaacaatag

DBGET integrated database retrieval system