KEGG   Haemophilus somnus 129PT: HS_0775Help
Entry
HS_0775           CDS       T00386                                 

Gene name
pldB
Definition
lysophospholipase L2 (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
hso  Haemophilus somnus 129PT
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:hso00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    HS_0775 (pldB)
Enzymes [BR:hso01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     HS_0775 (pldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
830702..831658
Genome map
AA seq 318 aa AA seqDB search
MSQHESHFNHFALAELYPFATQFPLQNIIGKKGIRIVYRHFVQEHCAERRLVILVNGRAE
NLLKWTELAYNFYRQGYDVLAFDHRGQGYSQRLLKDHDKGYIDEFRFYADDLTLLVEKIT
SLYHYRSQHILAHSLGALISTYYLANDNHQIKSAVFSAPFYGIPLQHSLRDEFIINLMML
LGQGSRYVFGKGEYKPADLDKNDLSLCRTRMKWMNRINRRYPHIHLGGPTFRWVYECMYA
IKKLPVVLPRIEIPVLVLQSEREKIVDNQNLQKLTALLPQAQLVQIEHSRHEILFERDRI
RDLALAKINQFFTENNAK
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaacatgaatctcacttcaatcattttgccttagccgaactttatccttttgct
acacaatttcctttgcaaaatataataggaaaaaaaggaatacgaatcgtctatcgccat
tttgttcaagaacattgtgctgaacgcagattagtgattttggtcaatggacgtgcagaa
aacttgttgaaatggacagagttggcttataacttttatcgacaaggctatgatgtttta
gcgtttgatcatcgtggacaaggctattctcagcgtttattaaaagaccatgacaaaggc
tatattgatgagtttcgtttttatgcggatgatcttactttgttagtggaaaaaattact
tcgttgtatcactatcgcagccaacatattttggcacattctttaggcgctttaatcagc
acttattatcttgccaatgataatcaccaaataaaaagtgcggtattttctgcaccattt
tatggtattccactacagcattcattacgagatgaattcattattaatttaatgatgttg
cttgggcagggctcacgctatgtatttggcaaaggtgagtataaacccgctgatttagat
aagaatgatttgagtctttgtcgtactagaatgaaatggatgaatcgtattaatcgtcga
tacccacatattcatttaggcggaccaacttttcgttgggtatatgagtgtatgtatgcc
attaaaaaattacccgttgtcttaccccgaattgaaattccggtactagttttacaatca
gaaagagaaaaaattgtggataaccaaaatctgcaaaaattgaccgcacttttgcctcaa
gctcaactagtgcagattgaacatagtaggcatgagattttatttgaacgtgatcgaatt
cgagatttagcactagcaaaaatcaatcagttttttactgaaaataacgccaaataa

DBGET integrated database retrieval system