KEGG   Haemophilus somnus 129PT: HS_0784Help
Entry
HS_0784           CDS       T00386                                 

Gene name
dld
Definition
(GenBank) D-lactate dehydrogenase
  KO
K03777  D-lactate dehydrogenase (quinone) [EC:1.1.5.12]
Organism
hso  Haemophilus somnus 129PT
Pathway
hso00620  Pyruvate metabolism
hso01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hso00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    HS_0784 (dld)
Enzymes [BR:hso01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.12  D-lactate dehydrogenase (quinone)
     HS_0784 (dld)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lact-deh-memb FAD_binding_4 Hydantoinase_A
Motif
Other DBs
NCBI-ProteinID: ABI25059
UniProt: Q0I2K1
Position
complement(839284..840975)
Genome map
AA seq 563 aa AA seqDB search
MTTQQLISKLTDIVGNKFIITDPSKTESYRSGYRFGNGNAIAVVRPTNLVEYWNVLKACV
EADVIIINQAANTGLTGGSTPSGNDYDRDIVIINTMYMNGIQLINNAEQAVCLPGSTLNE
LEILLKTHGREPHSVIGSSCIGASVIGGICNNSGGALVQRGPAYTEMALYAQLNEQGELE
LKNHLGIDLGNDPEEILENLQNQRYQRKDIQQHCGRGHDHSYCEHVRQIDENSPARFNAD
PSRHYETSGSAGKLAVFAVRLDTFPMEKHTAVFYIGTNQTDVLNDIRRHMLANFQQLPIS
GEYIHRDAFDIAAKYGKDTFWIIKKFGTHRLPKLFALKAKVDRIAKKVSFLPNDFSDKFM
QILSKAMPEHLPKSLWQYRDQYEHHLIVKIGGTGVQEAQEYLKEYFSDNSKGNYFQCNAE
ETQAAMLHRFAVASAAIRYRAIHDKDVEDIVALDVALRRNDKEWFEKLPAEIENKIIHKL
YYGHFMCHVFHQDYIIKKGHNCTELEHQMLDLLDQRGAEYPAEHNVGHLYQAKPELRKFY
KALDPTNSFNPGIGQTSKKKYWQ
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgacaactcaacaacttatctccaagctcaccgacattgtaggcaataaatttattatt
acagatccaagtaaaactgaaagttatcgtagcggctatcgttttggcaacggaaatgcg
attgctgttgttcgccctaccaatttggttgaatattggaacgtattaaaagcctgtgtt
gaggctgatgtaattattatcaatcaagcggcaaataccggtttaaccggaggatcaaca
ccaagcggtaatgactatgatcgtgatattgtgattatcaatacaatgtatatgaacggt
attcagctaatcaataatgccgagcaagccgtttgcttacctggttcgacattaaatgaa
ttggaaattttattaaaaacacatgggcgtgagcctcattccgttatcggttcatcctgt
attggtgcttctgttattggcggtatatgtaataattcaggcggtgcattggtgcaaaga
ggaccggcttacacagaaatggcactttatgctcaacttaatgaacagggagaattggag
ctcaaaaatcatttaggcattgacttaggtaatgatcctgaagaaattttggaaaattta
caaaaccaacgttatcaacgcaaagatattcaacaacattgtggcagaggacacgatcat
tcttattgcgaacatgtacgccaaattgatgaaaactctccagcaagatttaacgctgat
ccaagccgacattatgaaacttccgggagtgccggaaaattagctgtttttgcagtccgc
ttagatacgtttccgatggaaaaacataccgcagttttctacattggaacaaatcaaaca
gatgtattaaacgacattcgtcgtcatatgttagctaatttccaacaattgccaatctct
ggcgaatatattcatcgtgatgcttttgacattgccgccaaatacggtaaagatactttt
tggattattaaaaaatttggcacacaccgcttacctaaattatttgccttgaaagctaaa
gttgaccgaatcgccaaaaaagtcagttttttacccaatgatttcagtgataagtttatg
caaattttatcaaaagcgatgccggaacatttaccgaaatctttatggcaataccgtgac
caatatgaacatcatcttattgtaaaaataggtggtacaggtgttcaagaagctcaagaa
tacttaaaagagtatttttccgataactctaaaggtaattatttccaatgtaatgcagaa
gaaactcaagcagcaatgttacaccgttttgctgttgcttcagctgcaattcgttatcgt
gcaattcacgataaagatgttgaagatatcgttgctttggatgttgccttgcgtcgtaat
gacaaagaatggtttgaaaaattacctgctgaaattgaaaataaaattatacacaaactt
tattacggtcattttatgtgccatgtttttcaccaagactatatcattaaaaaaggtcat
aattgtacagaattggaacaccaaatgcttgatttattagatcagcgtggtgcggaatat
ccagcggaacataatgttgggcatttgtatcaagcaaaaccggaattacgcaaattctac
aaagcccttgacccaacaaatagtttcaatccgggaataggtcaaacctcaaagaaaaaa
tattggcaataa

DBGET integrated database retrieval system