KEGG   Haemophilus somnus 129PT: HS_0784Help
Entry
HS_0784           CDS       T00386                                 

Gene name
dld
Definition
D-lactate dehydrogenase (EC:1.1.1.28)
Orthology
K03777  
D-lactate dehydrogenase [EC:1.1.1.28]
Organism
hso  Haemophilus somnus 129PT
Pathway
Pyruvate metabolism
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:hso00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(839284..840975)
Genome map
AA seq 563 aa AA seqDB search
MTTQQLISKLTDIVGNKFIITDPSKTESYRSGYRFGNGNAIAVVRPTNLVEYWNVLKACV
EADVIIINQAANTGLTGGSTPSGNDYDRDIVIINTMYMNGIQLINNAEQAVCLPGSTLNE
LEILLKTHGREPHSVIGSSCIGASVIGGICNNSGGALVQRGPAYTEMALYAQLNEQGELE
LKNHLGIDLGNDPEEILENLQNQRYQRKDIQQHCGRGHDHSYCEHVRQIDENSPARFNAD
PSRHYETSGSAGKLAVFAVRLDTFPMEKHTAVFYIGTNQTDVLNDIRRHMLANFQQLPIS
GEYIHRDAFDIAAKYGKDTFWIIKKFGTHRLPKLFALKAKVDRIAKKVSFLPNDFSDKFM
QILSKAMPEHLPKSLWQYRDQYEHHLIVKIGGTGVQEAQEYLKEYFSDNSKGNYFQCNAE
ETQAAMLHRFAVASAAIRYRAIHDKDVEDIVALDVALRRNDKEWFEKLPAEIENKIIHKL
YYGHFMCHVFHQDYIIKKGHNCTELEHQMLDLLDQRGAEYPAEHNVGHLYQAKPELRKFY
KALDPTNSFNPGIGQTSKKKYWQ
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgacaactcaacaacttatctccaagctcaccgacattgtaggcaataaatttattatt
acagatccaagtaaaactgaaagttatcgtagcggctatcgttttggcaacggaaatgcg
attgctgttgttcgccctaccaatttggttgaatattggaacgtattaaaagcctgtgtt
gaggctgatgtaattattatcaatcaagcggcaaataccggtttaaccggaggatcaaca
ccaagcggtaatgactatgatcgtgatattgtgattatcaatacaatgtatatgaacggt
attcagctaatcaataatgccgagcaagccgtttgcttacctggttcgacattaaatgaa
ttggaaattttattaaaaacacatgggcgtgagcctcattccgttatcggttcatcctgt
attggtgcttctgttattggcggtatatgtaataattcaggcggtgcattggtgcaaaga
ggaccggcttacacagaaatggcactttatgctcaacttaatgaacagggagaattggag
ctcaaaaatcatttaggcattgacttaggtaatgatcctgaagaaattttggaaaattta
caaaaccaacgttatcaacgcaaagatattcaacaacattgtggcagaggacacgatcat
tcttattgcgaacatgtacgccaaattgatgaaaactctccagcaagatttaacgctgat
ccaagccgacattatgaaacttccgggagtgccggaaaattagctgtttttgcagtccgc
ttagatacgtttccgatggaaaaacataccgcagttttctacattggaacaaatcaaaca
gatgtattaaacgacattcgtcgtcatatgttagctaatttccaacaattgccaatctct
ggcgaatatattcatcgtgatgcttttgacattgccgccaaatacggtaaagatactttt
tggattattaaaaaatttggcacacaccgcttacctaaattatttgccttgaaagctaaa
gttgaccgaatcgccaaaaaagtcagttttttacccaatgatttcagtgataagtttatg
caaattttatcaaaagcgatgccggaacatttaccgaaatctttatggcaataccgtgac
caatatgaacatcatcttattgtaaaaataggtggtacaggtgttcaagaagctcaagaa
tacttaaaagagtatttttccgataactctaaaggtaattatttccaatgtaatgcagaa
gaaactcaagcagcaatgttacaccgttttgctgttgcttcagctgcaattcgttatcgt
gcaattcacgataaagatgttgaagatatcgttgctttggatgttgccttgcgtcgtaat
gacaaagaatggtttgaaaaattacctgctgaaattgaaaataaaattatacacaaactt
tattacggtcattttatgtgccatgtttttcaccaagactatatcattaaaaaaggtcat
aattgtacagaattggaacaccaaatgcttgatttattagatcagcgtggtgcggaatat
ccagcggaacataatgttgggcatttgtatcaagcaaaaccggaattacgcaaattctac
aaagcccttgacccaacaaatagtttcaatccgggaataggtcaaacctcaaagaaaaaa
tattggcaataa

DBGET integrated database retrieval system