KEGG   Haemophilus somnus 129PT: HS_0958Help
Entry
HS_0958           CDS       T00386                                 

Gene name
sucB
Definition
2-oxoglutarate dehydrogenase E2 component (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
hso  Haemophilus somnus 129PT
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hso00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HS_0958 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HS_0958 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    HS_0958 (sucB)
Enzymes [BR:hso01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     HS_0958 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1057301..1058524)
Genome map
AA seq 407 aa AA seqDB search
MSNFDIITPDLPESVADATVVTWHKNVGDAVKCDEVLVEIETDKIVLEIPALSDGVLETI
LQPEGSTVVSKQLLGKVSASAGIGEVTKSTVQNVEKTPADRHSANLNTDASSDVLSPAVR
RLLAEHELNADEIKGTGVGGRITREDIALVVKQKAQQTETAQASQSIATGLKIDHRNEKR
VPMTRLRKRIAERLLEAKNTTAMLTTFNEVDMQPIMNLRKRYAEKFEKQHGARLGFMSFY
IKAVVEALKRYPEINASIDGDDIVYHNYFDISIAVSTPRGLVTPVVRNCDKLSMADIEKE
IKLLAEKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPVAV
NGEVVIRPMMYLALSYDHRLIDGRESVGFLVTVKDLLEDPTRLLLEI
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatttcgatattattactccggatctccctgaatctgtggcggatgcaaccgtt
gtaacgtggcataagaacgtgggtgatgcggtaaaatgtgatgaagttttagtggaaatt
gaaactgataaaattgtgttggaaattcccgcacttagtgatggagtgcttgaaactatt
ttacaaccggaaggttcaactgtcgtgagtaaacaattgttgggtaaagtatccgcttcg
gcaggtattggagaagttacaaaatcaactgtacagaatgtggaaaaaacaccggcagat
cgtcattcggctaatttgaatactgatgcaagtagcgatgtactgagtccggctgttcgt
cgtttgttagcggagcatgaattaaatgctgatgaaattaaaggtacaggtgtaggtggt
cgaattactcgtgaagatatagcgttagtggttaagcaaaaagcacaacaaacagaaacg
gcacaagcatctcagtctattgcaactgggttgaaaattgatcatcgcaatgaaaaacgt
gtaccaatgacacgtttacgtaagcgtatcgcagagcgtttactggaagcaaaaaatact
actgcgatgctgacgacatttaatgaagtggatatgcagccgattatgaatttacgcaag
cgttatgcagaaaaatttgagaaacaacatggtgcacgcttaggatttatgtctttttat
atcaaagcggtggttgaagcactaaaacgctatccagagattaacgcatctattgatggt
gatgatattgtttaccacaattattttgatattagtattgctgtttccacacctcgtggt
ttggtaacgccggttgtacgtaattgcgataaattaagtatggcagatattgaaaaagaa
attaaattgttggcggaaaaaggtcgtgatggaaaattgaccgttgaagatttaacgggg
gggaattttactattactaacggtggcgtttttggttctttaatgtcaacacctattata
aatccgccacaaagtgcgattttgggtatgcatgcgattaaagatcgtcccgttgcggtt
aatggtgaagtggttattcgcccaatgatgtatttggcactaagctatgatcatcgttta
atcgatggacgtgaaagcgtcggtttcttggtgacagtgaaggacttgctggaagatccg
actcgcttgctactggaaatttag

DBGET integrated database retrieval system