KEGG   Haemophilus somnus 129PT: HS_1025Help
Entry
HS_1025           CDS       T00386                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
hso  Haemophilus somnus 129PT
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hso00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HS_1025 (folK)
Enzymes [BR:hso01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     HS_1025 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1133575..1134051
Genome map
AA seq 158 aa AA seqDB search
MKTVYIALGSNLDTPIQQLNLALGSLAQLKSCKLSAVSSFYQSKPLGPQDQPDYVNAVAC
LKTELDPIALLDQLQHIENQQGRVRLRRWGERTLDLDILLYGNEIIQNERLTIPHYDMKN
REFVIIPLYEIAPHLILPHGEKLADIMLNFTHHKMQKL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgaagactgtttatatcgctttaggaagtaaccttgatacgcctatacaacaactaaat
ctggcactaggttcattagctcaactcaaaagttgtaaattaagtgcggtaagttctttt
tatcaaagtaaacctcttggtccacaagatcaaccggattacgtgaatgcggttgcttgt
ttaaaaaccgaattagatccgatagccctattggatcaattacaacatatagaaaaccaa
caaggacgagtgcggttacgtcgttggggtgaacgtactttagacttagatattttgtta
tatggcaatgaaattatccaaaatgaacgcttaacaattcctcattacgatatgaaaaat
cgtgaatttgttatcattcctctttatgaaattgcaccacatctcattttacctcatggc
gaaaaattagcggatataatgctcaatttcactcatcataaaatgcaaaaattataa

DBGET integrated database retrieval system