KEGG   Haemophilus somnus 129PT: HS_1094Help
Entry
HS_1094           CDS       T00386                                 

Gene name
aceF
Definition
(GenBank) pyruvate dehydrogenase, E2 complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
hso  Haemophilus somnus 129PT
Pathway
hso00010  Glycolysis / Gluconeogenesis
hso00020  Citrate cycle (TCA cycle)
hso00620  Pyruvate metabolism
hso01100  Metabolic pathways
hso01110  Biosynthesis of secondary metabolites
hso01120  Microbial metabolism in diverse environments
hso01130  Biosynthesis of antibiotics
hso01200  Carbon metabolism
Module
hso_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hso00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HS_1094 (aceF)
   00020 Citrate cycle (TCA cycle)
    HS_1094 (aceF)
   00620 Pyruvate metabolism
    HS_1094 (aceF)
Enzymes [BR:hso01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     HS_1094 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_D23 RnfC_N HlyD_3 GCV_H
Motif
Other DBs
NCBI-ProteinID: ABI25369
UniProt: Q0I452
Position
complement(1224888..1226645)
Genome map
AA seq 585 aa AA seqDB search
MEVPSPEAGVIKEVLVKVGDKVSTGTPMFVLENAELASTETASKSMQTEKTQSAVASIIE
IYVPDIGGDEVNVTDIMVSVGETVAEEQSILNVEGDKASMEVPAPTAGIVKEILIKVGDK
VSTGSLVMKFEVAGVVSAAETAQVSSSAQVTGESAVQDVHVPDIGGDEVNVTEIMVAVGD
SVTEEQSLITVEGDKASMEVPAPFAGVVKEILVKSGDKVSTGSLIMRFEVQGKAPTPEAS
SAVTEAKVDPSPAAQENQMTPVSQADVTASAVFAHATPVVRRLAREFGVNLDKVKGTGRK
GRILKEDVQAYVKAAIKAVESGNVSPTSAGNGAVNGAGLGLLPWPKVDFSKFGDIEQVEL
GRIQKISGANLHRNWVMIPHVTQWDKADITELEKFRKEQNVLAEKQKLDVKITPLVFIMK
AVAKALENYPRFNSSLSEDAQSLILKKYINIGVAVDTPNGLVVPVFKDVNKKGIIELSRE
LAEISKKARAGKLTASDMQGGCFTISSLGGIGGTHFTPIVNAPEVAILGVSKSEMTPVWN
GKDFTPRLMLPLSLSYDHRVIDGADGARFITFINSVLSDLRRLVM
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggaagttccatcaccggaagcgggtgtcattaaggaagttttagtaaaagtaggcgac
aaagtttctactggaactccaatgtttgtattagagaatgcagaattagcatctaccgag
acagcatctaaaagtatgcaaaccgaaaaaacacaaagtgcggtagcgtctatcattgaa
atttatgtacctgacattggtggtgatgaagtcaatgtaactgatattatggtttctgta
ggtgagacagttgcagaagagcagtctattttaaatgttgagggtgataaagcctcaatg
gaagtgcctgcccctactgccggtatagtaaaagaaattttaatcaaagtgggagataaa
gtgtcgaccggttctcttgtgatgaaatttgaagttgcaggtgttgtatctgcagccgaa
acagctcaagtttcttcttcagctcaagtaacaggtgaaagtgcggtgcaagatgtacac
gttcctgatatcggtggtgatgaagtcaatgtgacagaaattatggttgcagtgggcgat
agtgttacagaggaacaatctttaattactgttgaaggtgataaagcttcaatggaagtg
cctgctccttttgctggtgtagtgaaagaaattttggtgaaatcaggggataaagtttca
actggttcattaattatgcgttttgaagtgcaaggaaaagcccctactccagaagcatca
tcggcggtgacagaggctaaagtggatccatctccagctgcacaagaaaatcaaatgacg
ccagtgtctcaagctgatgtgactgcaagtgcggtgtttgctcatgcaactccggttgtt
cgtcgtctagctagagagttcggtgtgaacttagacaaggtaaaaggaacgggtcgtaaa
ggtcgcatcttaaaagaagatgttcaggcttatgtaaaagcggcaattaaagcggttgaa
agtggcaatgtttctcctacatcagcaggtaatggtgctgtcaatggagcagggctaggc
ttgttaccttggccgaaagtcgacttcagtaaatttggtgatattgagcaagttgagttg
ggtcgtattcagaaaatctccggtgcaaacttacatcgtaactgggtaatgattcctcat
gttacgcaatgggataaagcagacattacggaactggaaaaattccgcaaagagcaaaat
gtgttggcggaaaaacaaaaacttgatgtaaaaattacgccattagtatttattatgaag
gccgttgctaaagcgttagagaattaccctcgctttaatagttcattatcagaagatgct
caaagcctgattctgaaaaaatacattaatattggagtggcggttgatacacctaacggt
ttggttgtacctgtgtttaaagatgtgaataaaaaaggcattattgaattatctcgtgaa
ttagcggaaatttctaagaaggctcgagctggtaaattaaccgcatcagatatgcaaggt
ggttgttttactatttcaagtctaggaggaattggcggtacacactttacgccaattgta
aatgctccggaagtcgcaattttgggcgtatctaaatctgaaatgacaccggtatggaat
ggcaaagattttactcctcgcttaatgcttccgttatctttgtcttatgatcatcgtgta
attgacggtgctgatggagcaagatttattactttcattaatagtgtattaagcgatctt
cgtcgtttagttatgtaa

DBGET integrated database retrieval system