KEGG   Haemophilus somnus 129PT: HS_1117Help
Entry
HS_1117           CDS       T00386                                 

Gene name
galU
Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hso  Haemophilus somnus 129PT
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hso00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HS_1117 (galU)
   00052 Galactose metabolism
    HS_1117 (galU)
   00500 Starch and sucrose metabolism
    HS_1117 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    HS_1117 (galU)
Enzymes [BR:hso01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HS_1117 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1253061..1253972)
Genome map
AA seq 303 aa AA seqDB search
MALIKEIKMKVIIPVAGLGTRMLPATKAIPKEMLTLVDKPLIQYVVNECVNAGIKEIVLV
THSSKNAIENHFDTSFELETMLEQRVKRQLLDEVRSICPTGVTIMHVRQGNAKGLGHAVL
CGRAIVGKEAFAVVLPDVLLAEFDSNQKTENLAAMLKRFKETGNSQIMVSPVPDKDISSY
GIVDCGGVTLNVGESVKISNIIEKPSFDDAPSNLSVVGRYVFSATIWDLLEKTPVGVGNE
IQLTDAIGMLIEKEVVEAFHMTGKAFDCGDKIGYMQAFVEYGLQHPQLGENFKTYLKQLV
QDL
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggctctaattaaggaaattaaaatgaaagtaattattcctgttgccggcttaggaacg
cgtatgttgccagcaactaaagcaattcccaaggaaatgttaacgttggttgacaaaccg
ttaattcagtatgtcgttaatgaatgtgttaatgcagggattaaagagattgtgctggta
acgcattcttccaaaaatgccatagaaaatcattttgatacatcttttgagttagaaaca
atgttggaacagcgtgttaaacgccagcttttagatgaagttcgttctatttgtccgaca
ggcgttactattatgcatgttcgtcaagggaatgctaagggactagggcatgctgtactt
tgcgggcgagcaattgttggcaaggaagcttttgccgttgttttacctgatgtattactt
gctgaatttgatagtaatcaaaaaacagaaaatcttgctgcaatgctgaagcgttttaaa
gaaacgggaaatagtcagataatggtttcacctgtacctgataaagatattagtagttat
ggtattgttgattgtggcggtgttactttaaatgttggtgagagtgttaaaatctcaaat
attattgagaaaccctcatttgatgacgcaccttccaatttgtctgttgttgggcgttat
gttttttcagcgacaatttgggatctattggaaaaaacgccagttggtgtcggtaatgaa
atccaattaactgatgctattggtatgctaattgaaaaagaagtggttgaagcatttcat
atgaccggcaaggcttttgattgtggagataaaataggatatatgcaagcctttgtggaa
tatggtttacaacaccctcaattaggggagaattttaaaacctatttgaaacaactggtg
caggacttgtag

DBGET integrated database retrieval system