KEGG   Haemophilus somnus 129PT: HS_1167Help
Entry
HS_1167           CDS       T00386                                 

Gene name
murZ
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
hso  Haemophilus somnus 129PT
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hso00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    HS_1167 (murZ)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HS_1167 (murZ)
Enzymes [BR:hso01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     HS_1167 (murZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1320468..1321742)
Genome map
AA seq 424 aa AA seqDB search
MQKFRVYGQSRLNGEVNISGAKNAALPILFAAILAEEPVKLTNVPELKDIDTTLKILQQL
GVVTYRDEQGAVHLDASNINHFVAPYELVKTMRASIWALAPLVSRFKQGQVSLPGGCSIG
ARPVDLHISGLERLGAKIVLEEGYVKAFVDGQLIGKRIVIEKVSVGATLSIMIAATLAKG
ITVIENAAREPEITDTAVFLNKMGAKISGAGSDIITIEGVERLGGCEHSIVPDRIETGTF
LVAAAISGGRIICKNTKASTLDAVIDKLRDAGAKIEVTENTITLDMQGNRPKAVNIRTEP
YPGFPTDMQAQFTLLNMVAEGSSKITETIFENRFMHIPELIRMGGKAEIEGNTAFCHGVE
YLSGAEVMATDLRASISLVLAGCIATGETIVDRIYHIDRGYEHIEKKLRGLGAKIERFTE
KIVD
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaatttcgtgtttatgggcagtctcgtttaaatggagaagtgaatatttccggt
gctaaaaatgctgccttacctattttgtttgcggccattctagctgaagagcctgtcaaa
ttaactaatgtacctgagttaaaagatattgataccacgttaaaaattctgcaacaatta
ggtgtggtaacttatcgagatgaacaaggtgcggtgcatttagatgcttcaaatattaat
cattttgtagctccttatgagttggttaagacgatgcgtgcgtctatttgggcattggct
cctttagtatctcgttttaaacaagggcaagtttcattaccgggaggttgttctattggt
gcaagacctgttgatttacatatcagcgggctggagcgacttggagcaaaaattgtattg
gaagagggttatgttaaggcttttgttgatggtcaattaatcggtaaacgaattgttatt
gagaaagtaagtgttggtgcgactttatctattatgatagcagcaactctagcgaaaggc
ataacagtaattgaaaatgcagctcgtgaacctgagatcactgatactgctgtattttta
aataagatgggagcaaaaattagcggtgcgggttcagatattatcacgatagaaggtgtt
gaacgcttgggcggttgtgagcatagtattgtgccggatcgtattgaaaccggtactttt
ttagttgcagccgctatttccggcggacgtatcatttgtaaaaatactaaagcatcaact
ttagatgcagtaattgataaattgcgtgatgccggtgctaaaattgaagtcacggaaaat
acgattacattggatatgcaaggtaatagaccaaaagcggtaaatatacgtactgaacct
tatcctggttttccaactgatatgcaagctcaatttactttattaaatatggttgcagag
ggttcaagtaaaattaccgagactatttttgaaaatcgttttatgcatattcctgaatta
attcgtatgggaggaaaggctgagattgaaggtaacacagcattttgtcatggtgttgaa
tatttatccggagcagaagttatggcaacggatttacgtgcttctatcagtcttgtctta
gctggttgtattgccacaggtgaaaccatcgttgatcgcatttatcacattgatcgtggt
tatgagcatattgaaaaaaaattacgtggattgggtgcgaaaattgaacgttttaccgaa
aaaatagtagactaa

DBGET integrated database retrieval system