KEGG   Haemophilus somnus 129PT: HS_1212Help
Entry
HS_1212           CDS       T00386                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hso  Haemophilus somnus 129PT
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hso00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HS_1212 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HS_1212 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HS_1212 (thrC)
Enzymes [BR:hso01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HS_1212 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1368815..1370092)
Genome map
AA seq 425 aa AA seqDB search
MNLYNIKHPEQQVSFSQAVRQGLGKDQGLFFPEKLPHFDDIDSLLSLPLVERSQKILTAL
IGAELSQETISAMVKNAFTFPAPMVKVEDNIYALELFHGPTLAFKDFGGRFMAQALAAVR
GDSKITILTATSGDTGAAVAHAFYGLENIEVVILYPKGKISPLQEKLFCTLGGNIRTVAI
NGDFDACQALVKQAFDDEELRQAVGLNSANSINISRLLAQVCYYFEAVAQLPKEIRQDIV
ISVPSGNFGNLTAGLIAKTLGLPIKRFIAATNANDTVPRYLNSGKWQPHTTVATLSNAMD
VSQPNNWPRVEELFKCNGWSLSELGSGALSDEETEKTLQAQYAKGYLCEPHGAIAYQVLK
DQLQVNETGIFLCTAHPAKFKENVERILSLELVLPETLDRYNKLPLLSDEMENDFAQLRA
YLLKK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaatttatataatattaaacatccggaacaacaagtaagtttttcacaagctgtgcgt
caaggtttaggaaaagatcagggcttattttttcctgaaaaattaccgcactttgacgac
attgatagccttttatctttgcctttggttgaacgcagtcaaaagattttaactgcttta
attggtgcggaattgtcacaagaaactattagtgcaatggtaaaaaatgcctttacattt
ccggcaccgatggtcaaagtagaagataatatctatgccttagaattattccacggtccc
acgttagcttttaaagactttggaggacgttttatggcacaagccttagcagctgtgcgt
ggagacagtaaaattactattttaactgctacttcaggcgataccggtgctgcggttgca
catgctttctatggcttagaaaatattgaggtagtgattttatatccaaaaggtaaaata
agtccgttacaagaaaaattattttgtacacttggcgggaatattcgaactgttgcgatc
aacggtgattttgatgcttgtcaagcattggtgaaacaagcctttgatgatgaagaactt
cgtcaagctgttggtttaaactctgcgaattcgattaatatcagtcgcttgttggcacaa
gtttgttattattttgaggcggttgcacagttaccgaaagaaattcgtcaagacattgtt
atttctgtgccgagcggtaatttcggtaacttaacagcgggattaattgccaaaacctta
ggcttaccaatcaaacgctttattgcggcaactaatgccaatgataccgttcctcgctat
ttgaatagcggaaaatggcagcctcatacaacggttgcgactctttccaatgcaatggat
gtgagccaaccgaataactggcctcgtgtagaagaattatttaaatgtaacggctggtct
ttaagtgaattgggttcaggtgcattgagtgatgaagaaacagaaaaaaccttgcaggca
caatatgccaaaggctatttatgcgaaccacatggggctattgcgtatcaggtgctaaaa
gatcaattacaggttaatgaaacgggtattttcctttgcacggcacatccagcaaaattc
aaggaaaacgttgagcgtattttaagtctcgagcttgtgcttccggaaacattggatagg
tacaacaagttgccattgctttctgatgaaatggaaaatgacttcgctcaattacgtgct
tatttattaaaaaaataa

DBGET integrated database retrieval system