KEGG   Haemophilus somnus 129PT: HS_1308Help
Entry
HS_1308           CDS       T00386                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
hso  Haemophilus somnus 129PT
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:hso03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1498316..1498921)
Genome map
AA seq 201 aa AA seqDB search
MQSSPLLENLIEHLRCLPGVGPKSAQRMAYHLLQRDRSGGMNLAGALTEAMSKIGHCTHC
RTFTEEESCAICNNPRRQNSGFLCVVEQPSDIPAIEQTGQFSGRYFVLMGHLSPLDGIGP
KEIGLDLLQKRLQHESFYEVILATNPTVEGEATANYIAEMCFQHNIKVSRIAHGIPIGGE
LETVDGTTLSHSLIGRREIQL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagcagtcctcttttagaaaatctgattgaacatttacgctgtttacccggcgtt
ggtcctaaatccgcacagcgtatggcatatcatttattgcaacgtgatcgtagcggtggt
atgaatttagctggtgctttaaccgaagcgatgtcgaaaattggtcattgtactcattgc
cgcacttttacggaagaagagagttgtgcaatttgtaataatccaagacgacaaaattcg
ggttttctttgtgttgtggaacagccttccgatattccggctattgagcaaacagggcaa
ttttccgggcgatattttgtgttaatgggacatttatctcctttagatgggattggtccg
aaagaaatcggtttggatttattgcaaaagcggttacaacatgaaagtttttatgaagtt
atcttagcaaccaatccaaccgttgaaggtgaggcaacagcgaattatattgcggaaatg
tgttttcaacataatataaaggtcagccgtattgctcatggtatccctataggaggggaa
ttggaaacagttgacggtacaactttaagtcattcacttattgggcgtcgtgaaattcaa
ctataa

DBGET integrated database retrieval system