KEGG   Haemophilus somnus 129PT: HS_1308Help
Entry
HS_1308           CDS       T00386                                 

Gene name
recR
Definition
(GenBank) DNA replication and repair protein RecR
  KO
K06187  
recombination protein RecR
Organism
hso  Haemophilus somnus 129PT
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:hso00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    HS_1308 (recR)
DNA repair and recombination proteins [BR:hso03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     HS_1308 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      HS_1308 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1498316..1498921)
Genome map
AA seq 201 aa AA seqDB search
MQSSPLLENLIEHLRCLPGVGPKSAQRMAYHLLQRDRSGGMNLAGALTEAMSKIGHCTHC
RTFTEEESCAICNNPRRQNSGFLCVVEQPSDIPAIEQTGQFSGRYFVLMGHLSPLDGIGP
KEIGLDLLQKRLQHESFYEVILATNPTVEGEATANYIAEMCFQHNIKVSRIAHGIPIGGE
LETVDGTTLSHSLIGRREIQL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagcagtcctcttttagaaaatctgattgaacatttacgctgtttacccggcgtt
ggtcctaaatccgcacagcgtatggcatatcatttattgcaacgtgatcgtagcggtggt
atgaatttagctggtgctttaaccgaagcgatgtcgaaaattggtcattgtactcattgc
cgcacttttacggaagaagagagttgtgcaatttgtaataatccaagacgacaaaattcg
ggttttctttgtgttgtggaacagccttccgatattccggctattgagcaaacagggcaa
ttttccgggcgatattttgtgttaatgggacatttatctcctttagatgggattggtccg
aaagaaatcggtttggatttattgcaaaagcggttacaacatgaaagtttttatgaagtt
atcttagcaaccaatccaaccgttgaaggtgaggcaacagcgaattatattgcggaaatg
tgttttcaacataatataaaggtcagccgtattgctcatggtatccctataggaggggaa
ttggaaacagttgacggtacaactttaagtcattcacttattgggcgtcgtgaaattcaa
ctataa

DBGET integrated database retrieval system