KEGG   Haemophilus somnus 129PT: HS_1388Help
Entry
HS_1388           CDS       T00386                                 

Definition
lysozyme, phage-related lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
hso  Haemophilus somnus 129PT
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1586124..1586660)
Genome map
AA seq 178 aa AA seqDB search
MSKLVKVGGICSVSAIIALMMLNFADNFRTSQQGLELIGQVEGCRRDPYHCPSDVLTVGI
GSTVASSGAIEPHKRYSDAEIAKRWVNDIQVAERCVNQFANGRLMPQSVFDSVVSITFNV
GCGKLSRSTMFRQANEKDWRGVCNEFPKWVYAGGKRLRGLEIRREKEKALCLSGVKQL
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagttggttaaagttggtggcatttgttcggtgtctgccattattgccttgatg
atgttgaattttgctgacaattttcgcacaagccaacaagggcttgagttaataggacag
gtagaaggctgtcgccgtgacccttatcattgcccttctgatgtgcttactgtaggaatt
gggagtactgtggcaagtagcggggcaattgaaccgcataagcgttattcagatgcagaa
attgcaaagcgttgggtaaacgatattcaagtagcagaacgttgtgtaaatcagttcgct
aacggtcggctaatgcctcaatctgtttttgattcagtggtttcaattacgtttaatgtt
gggtgcggtaagttatctcgctcgaccatgtttcgtcaagcaaatgaaaaagattggaga
ggtgtttgtaatgaatttccaaaatgggtttatgcaggcggtaagcgattacgaggactt
gaaatacgtagagagaaagagaaagcgttatgtttgtctggggtaaagcaactttaa

DBGET integrated database retrieval system