KEGG   Haemophilus somnus 129PT: HS_1445Help
Entry
HS_1445           CDS       T00386                                 

Gene name
gpmA
Definition
phosphoglyceromutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
hso  Haemophilus somnus 129PT
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hso00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HS_1445 (gpmA)
   01230 Biosynthesis of amino acids
    HS_1445 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HS_1445 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    HS_1445 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HS_1445 (gpmA)
Enzymes [BR:hso01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     HS_1445 (gpmA)
Exosome [BR:hso04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   HS_1445 (gpmA)
  Exosomal proteins of melanoma cells
   HS_1445 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1631734..1632417)
Genome map
AA seq 227 aa AA seqDB search
MELVFIRHGFSEWNAKNLFTGWRDVNLTERGIEEAKAAGKKLLEAGYEFDIAFTSVLTRA
IKTCNIVLEESNQLWIPQVKHWRLNERHYGALQGLDKKATAEQYGDEQVHIWRRSYDVSP
PDLDPQDPNSAHNDRRYALLPKDVVPNAENLKITLERVLPFWEDQIAPALLSGKRVLVTA
HGNSLRALAKHIIGISDEEIMAFEIPTGQPLVLKLDEQLNFVEKFYL
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggagttagtatttattcgccatggttttagtgagtggaatgccaaaaacttgtttacc
ggctggcgtgatgtgaatttaacagaacgtggtattgaagaagctaaagcggcaggtaaa
aaattacttgaagctggttatgaatttgatattgcatttacctcagttttaactcgggca
attaaaacctgcaatatcgtgttagaagaatctaaccaattatggattcctcaagtgaag
cactggcgtttaaatgagcgtcattacggtgctttacaagggttggataaaaaagcaact
gctgaacagtatggtgatgaacaagttcacatttggcgtcgttcttatgatgtttctcca
ccggatttagatccgcaagatccgaattctgcacataacgaccgccgttatgctctttta
cctaaagacgttgtgccaaatgctgagaacttaaaaatcactcttgaacgtgttctgcca
ttctgggaagatcaaattgcacccgcacttctttctggtaaacgtgtacttgtcactgca
cacggtaactctttacgtgcattagcaaaacacattatcggtatttctgatgaagaaatt
atggcttttgaaattccaactggtcagccgttagtgttaaaactggatgaacagttaaat
tttgttgagaaattctatctataa

DBGET integrated database retrieval system