KEGG   Haemophilus somnus 129PT: HS_1445Help
Entry
HS_1445           CDS       T00386                                 

Gene name
gpmA
Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
hso  Haemophilus somnus 129PT
Pathway
hso00010  Glycolysis / Gluconeogenesis
hso00260  Glycine, serine and threonine metabolism
hso00680  Methane metabolism
hso01100  Metabolic pathways
hso01110  Biosynthesis of secondary metabolites
hso01120  Microbial metabolism in diverse environments
hso01130  Biosynthesis of antibiotics
hso01200  Carbon metabolism
hso01230  Biosynthesis of amino acids
Module
hso_M00002  Glycolysis, core module involving three-carbon compounds
hso_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hso00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HS_1445 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    HS_1445 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HS_1445 (gpmA)
Enzymes [BR:hso01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     HS_1445 (gpmA)
Membrane trafficking [BR:hso04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    HS_1445 (gpmA)
Exosome [BR:hso04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   HS_1445 (gpmA)
  Exosomal proteins of melanoma cells
   HS_1445 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ABI25720
UniProt: Q0I4D8
Position
complement(1631734..1632417)
Genome map
AA seq 227 aa AA seqDB search
MELVFIRHGFSEWNAKNLFTGWRDVNLTERGIEEAKAAGKKLLEAGYEFDIAFTSVLTRA
IKTCNIVLEESNQLWIPQVKHWRLNERHYGALQGLDKKATAEQYGDEQVHIWRRSYDVSP
PDLDPQDPNSAHNDRRYALLPKDVVPNAENLKITLERVLPFWEDQIAPALLSGKRVLVTA
HGNSLRALAKHIIGISDEEIMAFEIPTGQPLVLKLDEQLNFVEKFYL
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggagttagtatttattcgccatggttttagtgagtggaatgccaaaaacttgtttacc
ggctggcgtgatgtgaatttaacagaacgtggtattgaagaagctaaagcggcaggtaaa
aaattacttgaagctggttatgaatttgatattgcatttacctcagttttaactcgggca
attaaaacctgcaatatcgtgttagaagaatctaaccaattatggattcctcaagtgaag
cactggcgtttaaatgagcgtcattacggtgctttacaagggttggataaaaaagcaact
gctgaacagtatggtgatgaacaagttcacatttggcgtcgttcttatgatgtttctcca
ccggatttagatccgcaagatccgaattctgcacataacgaccgccgttatgctctttta
cctaaagacgttgtgccaaatgctgagaacttaaaaatcactcttgaacgtgttctgcca
ttctgggaagatcaaattgcacccgcacttctttctggtaaacgtgtacttgtcactgca
cacggtaactctttacgtgcattagcaaaacacattatcggtatttctgatgaagaaatt
atggcttttgaaattccaactggtcagccgttagtgttaaaactggatgaacagttaaat
tttgttgagaaattctatctataa

DBGET integrated database retrieval system