KEGG   Haemophilus somnus 129PT: HS_1457Help
Entry
HS_1457           CDS       T00386                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
hso  Haemophilus somnus 129PT
Pathway
hso00230  Purine metabolism
hso01100  Metabolic pathways
Module
hso_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:hso00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    HS_1457 (gmk)
Enzymes [BR:hso01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     HS_1457 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin RsgA_GTPase MMR_HSR1 ABC_tran AAA_16 AAA_22 EFP AAA_23 AAA_29 AAA_35 cobW
Motif
Other DBs
NCBI-ProteinID: ABI25732
UniProt: Q0I5L8
Position
complement(1651420..1652058)
Genome map
AA seq 212 aa AA seqDB search
MGVIMCRGNLYIISAPSGAGKSSLISALLERDKNDSMTVSISHTTRSPRPGEIDGVHYHF
VSHEKFEQLILENSFLEYAKVFGGNYYGTSLLNIEKNLAAGIDVFLDIDWQGARQIREKR
PDVKSIFILPPSISALEKRLIGRGQDSQDIIAKRMEKAADEISHYDEYDYVIINADFDQA
LVDLEHILRAERLTVNYQKTQNAALIHQLLVK
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgggagtcattatgtgtaggggaaatttatatattatttctgccccaagcggagcaggg
aaatcttctttgatttcagcattattggaacgggataaaaacgatagtatgacggtgtcc
atatcacatacaacaagatccccaagaccgggtgaaattgatggggtgcattatcacttt
gtttcacatgaaaaatttgaacagcttattttagaaaactcatttttagaatatgcgaaa
gtattcggtgggaattattatggtacgtcattactgaatattgagaaaaatttagcggca
ggtatagatgtattcttggatattgattggcagggagcaagacaaattcgagaaaaacgt
cctgatgttaaaagtatttttattttgcctccttctatttctgctttagagaagcgtttg
attgggcgtggtcaagatagtcaagacattattgcaaagagaatggaaaaggcagcggat
gaaatctcccattatgatgaatatgattatgtcattattaatgctgattttgatcaagca
ttagtagatttagaacatattttgcgagctgaacgattgactgtaaattatcaaaaaacg
caaaatgcggctttaattcatcaattactagtaaaataa

DBGET integrated database retrieval system