KEGG   Haemophilus somnus 129PT: HS_1600Help
Entry
HS_1600           CDS       T00386                                 

Definition
beta-hexosamidase A
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
hso  Haemophilus somnus 129PT
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hso00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    HS_1600
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    HS_1600
Enzymes [BR:hso01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     HS_1600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1815405..1817165
Genome map
AA seq 586 aa AA seqDB search
MSVDLTKKPYYLKDEDIQWVKNTIANMTLEEKIGQLFVNMGSSRSEEYLTDVLNRYHIGA
VRYNPGPAEEVYDQNYILQTKSKIPLLIAANTEAGGNGACSDGTEIGLQVKIGATDDAKY
AYEMGRVAGIEAAAIGCNWSFAPIVDISYNWRNPIISNRVFGSNPEKVLEMSLAYMKGIQ
ESGIAPAAKHFPGDGVDERDQHLSFSVNSFSCEEWDNTFGKVYQGLIDAGLPSLMAGHIH
LPAYEQHFNPNLAYEDCLPATLSKPILTDLLRGKLGFNGVVVTDASHMVAMTSAMKRSEM
LPTAIAAGCDLFLFFNDPDEDFGYMMEGYKNGIITEERLHDALTRILGLKAKLGLHNRPR
ETLLEPKEQALAKIGLPEHKAIFRDVADKAITLVKHKQDIFPINVERFPRILLVNVKGTD
GGFGKMVAGSQRSATEILKEKLEEKGFTVSIYTSPMDNILKMSDEEQVKTIRNEYSQKRP
ITTLTDHYDLIINVANVQMSTVQRIVWQATKGTPDIPFYVHEVPTIFVSVQCPFHLVDVP
QVKTYINAYDGKEPTIELLVEKLMGNSEFKGISPVDAFCGYKDTRI
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgtctgttgatttaacgaaaaaaccttattacttaaaagatgaagatattcaatgggta
aaaaacactatagccaatatgacgttggaagaaaaaatcggtcagctttttgtgaatatg
ggttcaagcagatccgaggaatatctcactgatgttttaaaccgttaccatattggtgcg
gtacgttataatcccggtcctgctgaggaggtttatgaccaaaactatattctacaaact
aaaagtaaaatccctctcttaattgcagcgaatacagaagctggtggtaatggtgcttgc
agtgatggaacagaaattggtttacaagtcaaaatcggtgcaaccgatgatgctaaatat
gcttatgaaatggggcgtgtagctggtattgaagcagcagctatcggttgtaactggagt
tttgctcctatcgttgatattagttataactggcgaaacccaattatttctaatcgagta
tttggttcaaatccagagaaagtactagaaatgtccttggcttatatgaaaggcattcaa
gaaagtggtattgccccggctgcaaaacatttccctggtgatggagtggatgaaagagat
cagcatctttcttttagtgtaaacagttttagttgcgaagagtgggacaatactttcggc
aaagtttatcaaggcttaattgatgctggtttaccatcgttgatggcaggtcatatacac
ttacctgcttacgagcagcatttcaatccaaatttagcttatgaggactgcctaccagcg
acactttcaaaaccaattttaacagacttattacgaggtaaattaggtttcaacggtgtt
gttgttactgatgccagccatatggtagcaatgacttcagcaatgaagcgtagcgaaatg
ctaccgactgctatcgctgcaggttgtgatttattccttttctttaacgatcctgatgaa
gatttcggttatatgatggaaggttataaaaacggcattattaccgaagaacgccttcat
gatgcccttactcgtattctagggttaaaagcaaaattaggcttacacaatcgcccaaga
gaaacattgcttgaaccaaaagaacaagcattagcaaaaataggacttccagaacataaa
gcaattttccgtgatgttgcagataaagcaattaccttagttaaacataaacaagatatt
ttcccaattaatgttgaacgtttccctagaatcttacttgtaaatgttaaaggtacagat
ggtggcttcggtaaaatggttgcaggtagtcagcgcagtgcaacagaaatcttaaaagaa
aaactggaagaaaaaggatttaccgtttctatttatacatcaccgatggataatattctc
aagatgtcggacgaagaacaggtcaaaactattcgtaatgaatactcccaaaaacgccca
attacaacattaacggatcattatgatctgattatcaatgttgcgaatgtgcaaatgagt
acagttcaacgtatcgtatggcaagcgaccaaaggaacgcctgatattccattctatgta
catgaagtacctacaattttcgtttccgttcaatgcccattccatttagttgatgttcct
caggtaaaaacttacatcaatgcctatgacggcaaagaaccaaccatagaattactggta
gaaaaattaatgggtaattccgagtttaaaggtattagcccagttgatgctttctgtggt
tataaagacacccgtatttaa

DBGET integrated database retrieval system