KEGG   Haemophilus somnus 129PT: HS_1628Help
Entry
HS_1628           CDS       T00386                                 

Gene name
pckA
Definition
phosphoenolpyruvate carboxykinase (EC:4.1.1.49)
Orthology
K01610  
phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
hso  Haemophilus somnus 129PT
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hso00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HS_1628 (pckA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HS_1628 (pckA)
   00020 Citrate cycle (TCA cycle)
    HS_1628 (pckA)
   00620 Pyruvate metabolism
    HS_1628 (pckA)
Enzymes [BR:hso01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     HS_1628 (pckA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1854069..1855685
Genome map
AA seq 538 aa AA seqDB search
MTDLNKVINELGELGIYDVKEIVHNPSYEQLFEEETKPGLAGFEKGVVTTSGAVAVDTGI
FTGRSPKDKYIVLDEKTKNTVWWTSDAAKNDNKPMNQETWQSLKGLVTKQLSGKRLFVID
AFCGANPDTRLAVRIVTEVAWQAHFVKNMFIRPSDEELQNFKPDFTVMNGSKVTNPNWKE
QGLNSENFVAFNITEGVQLIGGTWYGGEMKKGMFSMMNYFLPLKGIASMHCSANVGKDGD
VAIFFGLSGTGKTTLSTDPKRQLIGDDEHGWDDDGVFNYEGGCYAKTIKLSAESEPDIYR
AIRRDALLENVVVREDGSVDFDDGSKTENTRVSYPIYHIDNIVKPVSKAGHATKVIFLTA
DAFGVLPPVSKLTPEQTKYYFLSGFTAKLAGTERGITEPTPTFSACFGAAFLSLHPTQYA
EVLVKRMKDSGAEAYLVNTGWNGTGKRISIKDTRGIIDAILDGSIESAEMGSLPIFDLAI
PKALPGVDPAILDPRDTYADKAQWQAKAEDLASRFVKNFEKYATNEEGKALIAAGPKA
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgactgacttaaacaaagtaataaatgaattaggtgaattaggcatctatgatgtaaaa
gagattgtccataatccgagttatgaacaactttttgaagaagaaaccaaaccgggttta
gcgggcttcgagaaaggtgttgttaccacttcaggtgcggttgcggtagatacgggaatt
tttaccggtcgttcgccaaaagataagtacattgttttagatgaaaaaacaaaaaatacg
gtatggtggacgagcgatgcggcgaaaaacgacaataagccgatgaaccaagaaacttgg
caaagtttgaaagggttggtcaccaaacagctttccggcaagcgtttgtttgttatcgac
gctttttgcggagcaaaccctgatacacgtttagcagtgcgtattgttactgaagttgca
tggcaggcacattttgtaaaaaatatgtttattcgtccgtctgatgaagaattgcaaaat
ttcaaaccggactttacggttatgaacggttctaaagtaactaacccgaattggaaagag
caaggattaaattcagagaactttgtggcatttaacattactgagggcgttcaattaatc
ggcggtacttggtacggcggtgaaatgaaaaaagggatgttctcaatgatgaactacttc
ttaccattaaaaggtatcgcctcaatgcactgttctgcaaacgtaggcaaagatggcgat
gtggcgattttcttcggcctatccggtacaggtaaaacaacgctttcaaccgatccgaaa
cgtcaattaatcggtgatgatgaacatggctgggatgatgacggtgtcttcaactatgaa
ggtggttgttatgcaaaaacaatcaaactttccgcagaaagcgagcctgatatttatcgt
gcaatcagacgtgatgcgttgttagaaaatgttgtcgttcgtgaggatggttccgttgac
tttgatgacggttcaaaaacggagaatactcgtgtatcttatccaatttaccacattgac
aatattgttaaaccggtatcaaaagcaggacatgcaacaaaagttatcttcttaacggca
gatgcgttcggtgtcttacctccggtttcaaaactcacacctgaacaaactaaatactac
ttcttatccggtttcactgcaaaattagctggtacagagcgtggcattactgagccgacg
ccaacattctctgcctgtttcggtgcggcattcttaagtttgcacccaacccaatacgca
gaagtgttggtaaaacgtatgaaagattctggtgctgaagcgtacttagtcaatacaggt
tggaacggtacaggtaaacgcatctcaattaaagatactcgtggcattatcgacgctatc
ttagacggctcaattgaaagtgcggaaatgggatcattaccaatcttcgatttggccatt
ccaaaagcattaccaggtgttgatcctgcaatcttagatcctcgtgatacttatgcggat
aaagcacaatggcaagcaaaagcggaagaccttgcaagtcgtttcgtgaaaaactttgaa
aaatatgctacaaatgaagaaggaaaagcacttattgcggcaggtcctaaagcttaa

DBGET integrated database retrieval system