KEGG   Harpegnathos saltator (Jerdon's jumping ant): 105191074Help
Entry
105191074         CDS       T03918                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD12
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
hst  Harpegnathos saltator (Jerdon's jumping ant)
Brite
Enzymes [BR:hst01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     105191074
Peptidases [BR:hst01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   105191074
Exosome [BR:hst04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   105191074
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 358 aa AA seqDB search
MKSTYLLLAAVPFAILDIWYTGICLIWTMKISAVTYLILVGLLPIIFHYSYTIQKKILFL
NFVQWPLKTDFSDPGSVGLEGARNFYLHTDQQVKIGIWQILPRSLLNNSIPATDEAYEKL
LSNAKYPVFLYMHGNSGNRASSHRVELYKLFQDLDYHVICFDYRSYGDSDVVELSELGVV
TDSKYVLEWVLKKVNSTVPVFVWGHSLGTGVSTHVLALLAAENIQPTGLFLEAPFNNIAD
ELTEHPFAQLFKHLPWFHWVIVEPFYNNNLRFESDKHISKIECPIMILHAEDDGIIPFFL
AEKLYHAAINSFGNNTDRIQMIKIDSSYGLGHKYICRYKELPDIIKTFVAKTYKNLTE
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcaacttatctactattagcagcagtgccattcgccatccttgatatttggtac
acaggaatatgtttaatttggaccatgaagatatctgcagtaacatacctcatcttagtt
ggacttctacctataatatttcattattcctatactatccaaaagaaaatattattttta
aattttgtacaatggccacttaaaacagacttttctgatccaggatcagtaggattagaa
ggtgctagaaatttttatttacatactgatcaacaagtaaaaataggcatatggcaaata
ttaccacgatctttattaaataattccatccctgcaacagacgaagcttatgaaaaactc
ctgagtaatgccaagtatcccgtgtttctgtacatgcatggaaacagtggtaatagagca
agttcacatcgcgttgagctttataaacttttccaagacttggattatcatgttatatgt
tttgattatagaagttacggagatagtgatgtagttgaactgtctgagttgggtgtagtt
acagatagtaaatatgttcttgagtgggtattgaaaaaagtaaatagtacagtgccagtt
ttcgtttggggtcattctttaggcactggagtctctacacacgtattagcactgctagca
gctgagaatatacaaccaacaggattatttctagaagcaccatttaataacatagctgac
gaattaacagaacatccatttgcacagctattcaaacatttaccatggttccattgggtg
attgttgaacctttttataacaataatctgcgatttgagtctgacaaacatatcagcaag
attgaatgtcctattatgatattgcatgctgaagatgatggaataattccattttttctg
gcagagaagctctatcatgcagcaattaatagttttggaaataatacagatcgaatccaa
atgatcaaaatagattcatcttacggacttggacataaatatatttgtaggtacaaggaa
ttgcctgatataattaagacatttgttgctaaaacatataaaaatctaactgaatag

DBGET integrated database retrieval system