KEGG   Hymenobacter swuensis: Hsw_1352Help
Entry
Hsw_1352          CDS       T03055                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
hsw  Hymenobacter swuensis
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:hsw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Hsw_1352
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Hsw_1352
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Hsw_1352
Enzymes [BR:hsw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Hsw_1352
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
Position
1528126..1529766
Genome map
AA seq 546 aa AA seqDB search
MLTSCDDDDEALQYTGDFGFREGVASFDPSQSSILLWTRYTPATNEPASADIRWELAEEA
GFGTLKASGTLTATAATDYTIWTEATGLASYKTYYYRFRNERTGATSVVGETRTLPAAGQ
TTRARLAVVSCANYQAGLFNVYGAVAESQADAVVHLGDYIYEYGAGGYGTNSNTASLNRS
HLPAGEILTLDDYRTRYRQYRSDKQLQLAHQRKAFICVWDDHELANDAYLTGAENHQPTE
GSFESRKQAAIQAWHEYLPARVTDKTRIYRRFEFGSLVNLLMLDTRLVGRDKQLSFSDYI
GSAGAFNTQAFGAAWLNPGRSLLGAEQRSWLTGQLAGNSARWQVLGSQVLMGKMYIPAEL
LTLVAQLAAGPTPALLAQYSTIAGQLAVIKTRILAGDPTVTATERARVETVLPYNLDAWD
GYPVEREAVLAAAGGKGLISLAGDTHNAWHSDLMVNSGRKVGAEFATSSVSSPGFEALLA
GSAAAIQGFEQSNQLLINDLQYLDASRRGFLEVEFTSSQATAQWKYVATLTTESTATTLG
RTATEV
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgttgaccagctgcgacgatgacgacgaggccctgcaatataccggtgactttggcttc
cgagagggtgtggccagcttcgaccccagccagagcagcatcctgctatggacccgctat
acgcccgccaccaatgagcccgcctcggcggatattcggtgggagctggccgaggaagct
ggtttcggtacgctcaaagccagtggtacgttaaccgctaccgccgccaccgactacacc
atctggaccgaagctaccggcctggccagttacaagacctactactaccgcttccgcaac
gagcgaaccggtgctacctcagtagtaggcgaaacccgcacgctgcccgccgccggccag
accacccgcgcccggctggcggtggtatcgtgtgccaactaccaggctgggctgttcaac
gtgtacggggccgtagcggagtcgcaggccgatgcggtagtgcatctgggcgactacatc
tacgaatacggggccggcggctacggcaccaactccaacacggccagtctgaaccgctct
catttgccggccggtgaaatcctgaccctcgacgactaccgcacccgctaccgccagtac
cgcagcgacaagcagctgcagctggcgcaccagcgcaaagccttcatctgcgtatgggac
gaccatgagctggcaaacgacgcctacctcactggggccgaaaaccaccagcccaccgaa
ggcagcttcgagagccgcaagcaggctgccattcaggcctggcacgaatacctgcccgcc
cgtgtaaccgacaaaacccgtatctaccggcgcttcgagttcgggagtctggttaacttg
ctcatgctggatacgcggctggtcgggcgcgataagcagctcagcttcagtgactacatc
gggagtgccggcgcgttcaatacgcaggcatttggggcggcctggctcaaccccggccgg
agcctgctgggggccgaacagcgcagttggctcacggggcaactagccggcaactcggcg
cgctggcaggtgctgggctcccaggtgctgatggggaaaatgtatattccggccgagctg
ctgacgctggtagcccagctggccgccggccccacgccggccctgctggcccagtacagc
acaatagccgggcagctggctgtcattaaaactcgcattctggccggcgaccccacggta
acggccaccgagcgggcccgcgtggaaacggtgctgccctacaacctcgatgcctgggac
ggctaccccgtggagcgggaggctgtgctggccgccgctggcggcaaagggctcatttcg
ctggccggcgacacgcacaatgcctggcacagcgacctgatggtgaacagtggccgcaaa
gtaggcgctgaatttgccacgtcctcggtttcctccccggggtttgaggcactgctggcc
ggcagcgcggcggctattcaggggttcgagcaatcaaatcagctgctcattaatgatttg
cagtacctggatgcttcccggcggggtttcctggaggtagaattcaccagcagccaggcc
accgcgcagtggaagtacgtggccacgctcaccaccgagagtaccgctaccaccctgggc
cgcaccgctacggaagtatag

DBGET integrated database retrieval system