KEGG   Hymenobacter swuensis: Hsw_1828Help
Entry
Hsw_1828          CDS       T03055                                 

Definition
O-glycosyl hydrolase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
hsw  Hymenobacter swuensis
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsw00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Hsw_1828
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Hsw_1828
Enzymes [BR:hsw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Hsw_1828
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(2103179..2104630)
Genome map
AA seq 483 aa AA seqDB search
MKLPFHLPLGLSCALLLGLAASCGSDGKSDPTPEPPLPPGPAGPSQVALWLTTTDQSTRF
YKSTLPLNFATATSQNLAIAVDTTQTYQTIDGFGYTLTGGSAQLLHQMGPADRAALLKEL
FATDGTSIGTSYLRLSIGASDLDAAPFTYNDTPQPDPTLAQFSLAPDRQHLLPVLKEILA
INPNIKILGSPWTAPTWMKTNGSFVGGSLKPEYYAAYAQYFVKYIQGMKAEGVTIDAVTL
QNEPLHDGNNPSMVMTATEQAAFIRANVGPALRAAGLSTKIIAYDHNLDRPDYPLTILQD
AQASQYVDGSAFHLYAGNISAMSTVHDAFPAKNVYFTEQWVGGPGNFNADFSWHMQNLII
GATRNWSRNVLEWNLAADQNYGPHTAGGCTNCLGAVTINGNAVTRNPAYYTVAHAAKFVR
PGSVRIGTNEPGNLQNVAFKNPDGKKVLIVLNGGSTSQTFDIQYRNKTLTTSLAAGAAGT
YVW
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaaattacccttccatcttcccctgggcctatcctgcgctctgctgctgggattggcc
gccagctgcggctccgacggcaaatcggacccgacgccggagccgccattgcctccgggg
ccggcgggtccgtcgcaggtagccctctggctaacgactaccgaccaatcgacgcggttt
tacaagagcacactgcctttgaattttgccacggctaccagccagaacctggctattgcc
gtcgataccacccagacgtaccagaccatcgacggcttcgggtacacgctgacgggtggt
agcgcccaattgctgcaccagatgggacccgctgaccgcgctgccctactcaaagagctg
tttgccaccgatggcaccagcatcgggaccagctacctgcgcctgagcatcggggcctcc
gacctggatgccgcccccttcacctacaacgatacgccccagcccgaccccacgctggcg
cagttcagccttgctcccgaccgccagcatctgctgccggtgctcaaggaaatcctggcc
atcaaccccaacatcaaaatcctgggctcgccttggacggccccgacctggatgaaaacc
aacggcagcttcgtgggtggttcgctgaaaccggaatactacgcggcctacgcccagtac
ttcgtgaagtatatccaggggatgaaggccgagggcgtaaccattgacgccgttacgctg
caaaacgagcctttgcacgacggcaacaaccccagcatggtgatgacggctacggagcag
gccgccttcatccgggccaacgtggggccggcactgcgggcagcggggctgagcaccaaa
atcattgcctacgaccacaacctcgaccggcctgattaccccctgaccatcctgcaggac
gcgcaggccagtcagtacgtcgatggctcggccttccatctgtacgccggcaacatctcc
gccatgagcacggtgcacgatgcgtttcctgccaaaaacgtgtacttcacggagcagtgg
gtaggcggccccggcaacttcaacgccgacttcagctggcacatgcagaacctcatcatt
ggggccacgcgcaactggagccgcaacgtgctggagtggaacctggccgccgaccagaac
tatggtccgcacacggccggcggctgcaccaattgcctgggtgccgtaaccatcaacggc
aacgccgtgacgcgcaacccggcttactacacggtggctcacgcggccaagttcgtgcgg
cccggctccgtgcgcatcggcaccaacgagcccggcaaccttcagaacgtggccttcaaa
aaccccgacgggaagaaagtgctcattgtgctgaatggcggcagcacctcccaaaccttc
gacatccagtaccgcaataaaaccctgaccacctccctggcggctggcgcggcgggtacc
tacgtgtggtga

DBGET integrated database retrieval system