KEGG   Hymenobacter swuensis: Hsw_2604Help
Entry
Hsw_2604          CDS       T03055                                 

Definition
alpha-amylase
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
hsw  Hymenobacter swuensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsw00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Hsw_2604
Enzymes [BR:hsw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Hsw_2604
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
2912974..2914782
Genome map
AA seq 602 aa AA seqDB search
MKAKLTVALSGLLAAGSLLSSCSKEELQPTATAVPQATTSGQNAVVTNGVMMQAFYWDVP
ISNAQGTWWQVLGSKAAELKAAGITALWLPPAYKGGSQSDVGYGVYDRYDLGEFNQKGTV
ATRYGTIGQLQTAIGAMKGQGLQVYEDMVMNHMAWADAQENVNGNLVYTKFNFPGRGNTY
SSYKWGFNNFTGTQQAPNNGWYQWKSWDFQPYANNDAYDNLLGSEIQYNNNAANQTETIN
WGNWITTKMSLDGYRLDATKHIYTPYVNQWLDAVKTNGRFAVSEAWFRNLQDLKNYAAAT
GGRTSLFDVPLHYTFQDMSNGNGAWDMRGLQFAGFTESNPTLSVSFVDNHDTDHPGALYS
PVTNLKMLAYAYILTRANGYPCVFYKDYYNYGLGNQIKTLNGIRQANAYGAAAEYTSVND
ADVYAYSRAGDATHKGLLMLLNDGSSARTKTITTPFKSATLTDKTGNTSGTVTTDANGTG
VFPVNSRSYAVWVPGGTTTTPPPTTGTTAVSFNVTYSGTVSGQDVYVLGSTAQLGAWNTA
NAIKLSGATYPVWKGTINLTSGTSVQYKYIRKDAAGNVLYEGGANRTFTPTGTSQTRTET
WQ
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaaaactgaccgtagccctatcggggctgctggcagctggttccctgttgtct
tcgtgcagcaaagaggaattgcagcctacagccacggccgtcccccaggccactacctcc
ggccagaatgccgtggtgaccaatggcgtgatgatgcaggccttctactgggatgtgccg
atcagcaacgcgcagggaacttggtggcaggtgctgggctccaaagccgccgagttgaag
gccgccggcattacggccctgtggctgcccccggcctacaaaggtgggagccagagcgac
gtcggctacggcgtgtatgaccgctacgacctgggcgaattcaaccagaaaggcaccgta
gccacgcgctacggcaccatcgggcagctgcaaactgccattggggctatgaaaggccaa
ggcctgcaggtgtacgaggacatggtgatgaaccacatggcctgggccgacgcgcaggaa
aacgtgaacggcaacctggtgtacaccaagttcaacttccccggccgcggcaacacgtat
agcagctacaagtggggcttcaacaacttcaccggcacgcagcaggcccccaacaacggc
tggtaccagtggaaaagctgggacttccaaccctacgccaacaacgacgcctacgacaac
ctgctgggctcggaaatccaatacaacaacaacgctgctaaccagaccgaaaccatcaac
tggggtaactggattaccaccaagatgagcctcgacggctaccgcctcgatgccaccaag
cacatttacacgccctacgtgaaccagtggctggacgcggtgaaaaccaacggccgcttt
gccgtgagtgaggcctggttccgcaacctgcaggacctgaagaactacgccgccgccacc
ggaggccgcaccagcctcttcgacgtgccgctgcactacaccttccaggacatgagcaac
ggcaacggcgcctgggacatgcgcgggctgcagtttgccggcttcaccgaatcgaatccg
acgctgtcggtgagcttcgtggataaccatgacaccgaccatcccggcgcgctgtactcg
cccgttaccaacctcaagatgctggcctacgcctacatcctgacccgcgccaacggctac
ccctgcgtattctacaaggactactacaactacggcctcggcaaccagatcaaaaccctg
aacggcatccgccaggccaacgcctacggtgccgccgccgagtacactagcgtaaacgac
gccgacgtatacgcctactcccgcgccggcgacgccacccacaaagggttgctgatgctg
ctgaacgacggcagctcggcccgcaccaagaccatcaccacgcccttcaagagcgccacc
ctcaccgataaaaccggcaacaccagcggcacggtaaccaccgacgccaacggtaccggc
gtattcccagtgaacagccgcagctacgcggtatgggtgcccggcggcaccactaccaca
cctcctcccaccaccggtaccacggccgtatcgttcaacgtcacgtacagcggcaccgta
tcgggccaggatgtgtacgtgctgggcagcaccgcccaactgggcgcctggaatacggcc
aacgccatcaagctcagcggcgccacgtatccggtgtggaaaggcacaatcaacctgacc
agcggtaccagcgtgcagtacaagtacatccgcaaggatgcggccggcaacgtgctctac
gaaggcggcgccaaccgcaccttcacgcccaccggcactagccagacccgcaccgaaacc
tggcagtag

DBGET integrated database retrieval system