KEGG   Hymenobacter swuensis: Hsw_2975Help
Entry
Hsw_2975          CDS       T03055                                 

Definition
glycoside transferase family protein
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
hsw  Hymenobacter swuensis
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:hsw00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Hsw_2975
Enzymes [BR:hsw01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     Hsw_2975
Glycosyltransferases [BR:hsw01003]
 Polysaccharide
  Storage polysaccharide
   Hsw_2975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
3378960..3380798
Genome map
AA seq 612 aa AA seqDB search
MQVPVPTPEPIAPDALLVEVAWEVCNQVGGIYTVIRSKVPATVQAWDDRYCLLGPYFAHQ
AQGEFEPYDDYQLATLSDPFAGAVREMRKQGYDVQLGIWLVTGRPRVVLINPYQGYPQLG
RIKSDLWHHHHIPMPDNDDLLHQVVAFGELAKVFLQILAAEVVPPQRLVAHFHEWMTGVA
IPALRREQVPVHLVFTTHATLLGRYLAMNDPNFYDHLMQVEWQGEAQHFNIEPAVTMERA
AAHGAHVFTTVSELTVRECIYLLDRIPDAVLPNGLNIERFVALHEFQNLHQQYKSKIHEF
VMAHFFQSYSFDLDKTLYLFTSGRYEYHNKGFDITLEALARLNYRLQQSGLEGNVVMFFI
TKRPFHSINPQVLQSRAVLEEVQATCEAIEQQVGERLFYAAAASTDHRLPDLSSMVDDYW
KLRYRRTLQSWKTTNLPPVITHNLVDDAGDDILNFLRRSNLVNNQHDRVKIVYHPDFVSP
TSPLFGMEYGQFVRGCHLGIFPSYYEPWGYTPLECVARGVPAITSDLSGFGDYVMQTVPG
HEDKGIFVVQRQEKSFDEAAEELTDMLWDFVQLTRRERIMQRNNVESSAELFDWKNLRVH
YDRAYQLALERQ
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtccccgttcccacgcccgaacctattgcccccgatgccttacttgtggaagtg
gcttgggaagtatgtaaccaggtaggcggcatctacaccgttatccgcagcaaagtaccc
gccaccgtgcaggcctgggacgaccggtactgcctgcttggcccgtatttcgcccaccag
gcccaaggcgagtttgaaccgtacgacgactaccagctggctaccctttctgacccgttt
gccggagccgtgcgcgagatgcgcaagcagggctacgatgtccagctgggcatctggctg
gtaacgggccggcctcgggtcgtcctcatcaacccttaccagggctatccgcagctgggc
cgtatcaagtctgacctctggcaccaccaccacatcccgatgcccgacaacgacgacctg
ttgcaccaggtggtggcattcggtgagctggccaaagtatttctgcagattctggcggcc
gaagtggtaccaccccaacggctggtggcccacttccacgagtggatgacgggcgttgcc
attccggcgctgcgccgcgagcaggtgccagtgcatctggtcttcaccacccatgctacc
ctgctggggcggtacctagccatgaacgaccccaacttctacgaccacctgatgcaggtg
gagtggcagggcgaggcgcagcattttaacattgagccggccgtgacgatggagcgcgcc
gccgcgcatggagcccacgttttcaccaccgtgagcgagctgacggtgcgggaatgcatt
tatctgctcgaccggattccggacgcggtactgcccaacggcctcaacattgagcggttt
gtagccctgcacgaattccagaacctgcaccagcaatacaagtcgaagattcacgagttt
gtgatggcgcactttttccagtcgtattccttcgacttggacaagacgctgtacctgttc
acctcgggccgctacgagtatcacaacaagggtttcgatattacgctggaagccctggcc
cgcctcaactaccgcctgcagcaaagcggcctggaaggcaacgtggtgatgttctttatc
accaaacggccattccatagcatcaacccgcaggtgctccagagccgggccgtgctagaa
gaagtacaggccacttgcgaagccattgagcaacaggtgggcgagcggctgttctatgcc
gccgccgccagcaccgaccaccgcctgcccgacctcagcagcatggtggatgactattgg
aagctacgctaccgccgcaccctgcaaagctggaagaccaccaatctgcctcccgtcatt
acccataacctggtggatgatgccggcgacgatatcctgaacttcctgcgccgctccaac
ctcgtcaacaaccagcacgaccgggtaaaaatcgtctatcatcccgatttcgtgtcaccc
acctcgcctttattcgggatggagtacgggcagtttgtgcgcggctgtcacctgggcatt
ttcccgagctactacgagccctggggctataccccgctggagtgcgtagcgcgcggcgta
ccggccattacctccgacctctccggtttcggcgactacgtgatgcaaacggtgcccggc
catgaagacaagggcatttttgtggtgcagcgccaagagaagagcttcgacgaggcggcg
gaagagctgacggatatgctctgggattttgtgcagctgacccgccgggagcggattatg
cagcgcaacaacgtggaaagctcagccgaactattcgactggaaaaacctgcgcgtgcac
tacgaccgggcttaccaactggccctggagcggcagtaa

DBGET integrated database retrieval system