KEGG   Hymenobacter swuensis: Hsw_3233Help
Entry
Hsw_3233          CDS       T03055                                 

Definition
fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
hsw  Hymenobacter swuensis
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:hsw00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Hsw_3233
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Hsw_3233
Enzymes [BR:hsw01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Hsw_3233
Lipid biosynthesis proteins [BR:hsw01004]
 Desaturase
  First
   Hsw_3233
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
3679070..3679825
Genome map
AA seq 251 aa AA seqDB search
MAILVFFVAHYYLSLFTQTFYLHRYAAHKMFTMNKFWEKFFFLFTYICQGSSFLSPRAYA
LLHRMHHAYSDTELDPHSPHFSSNAFSMMWKTKVIYGEVVENRYEEAKRFEGDTPEWKSL
EAFGGTAYSRIGWGALYVLFYVQFATAWWQFLLLPIHFLMGPIHGAIVNWGGHKYGYQNF
DNHDKSKNTLPFDFLAFGELFQNNHHKLPMRVNFGVKKWELDPTYAFIWVLDKVGIVKVK
RKWQEAVQMAA
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggcaatactcgttttcttcgtagcgcactactacctgtcgctctttacccagacgttt
tacctgcaccggtacgcggcccacaagatgtttacgatgaacaagttttgggagaagttc
ttcttcctgttcacgtacatctgccagggttcttcgttcctgtcgccgcgggcgtacgcg
ctgctgcaccgcatgcaccacgcctactccgatacggaactggacccccactcgccccac
ttctcttctaatgccttcagcatgatgtggaaaaccaaggtgatttatggcgaggtagta
gaaaaccgttacgaggaagccaagcgttttgaaggcgacactccggaatggaagtcgctg
gaggctttcggcggcacggcttactcccgcattggctggggcgcgctgtatgtgctgttc
tacgtgcagtttgccacggcctggtggcagttcctgctgctgcccatccacttcctgatg
ggccccatccacggcgccattgtgaactggggcggccacaagtacggctaccagaacttc
gataaccacgacaaatccaagaacacgctgcccttcgactttctggcgtttggtgagctg
ttccagaacaaccaccataagctgcccatgcgcgtcaacttcggcgtaaagaaatgggaa
ctggaccccacctacgcgttcatctgggtgttggataaagtgggcatcgtgaaagtaaaa
cgtaagtggcaggaagccgtccagatggccgcttag

DBGET integrated database retrieval system