KEGG   Hymenobacter swuensis: Hsw_3560Help
Entry
Hsw_3560          CDS       T03055                                 

Definition
hypothetical protein
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
hsw  Hymenobacter swuensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsw00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Hsw_3560
Enzymes [BR:hsw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Hsw_3560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
4013030..4015396
Genome map
AA seq 788 aa AA seqDB search
MYNGTNSWWRKLTLAAAALLVLGGQPAKAQKVVLQGYWWDYWNTNYPNGWANYIALLAPR
LKAMGIDAVWLPPSIKNGNQGNGYSPFDNYDLGDKYQKGFTATRLGNKDELLRAVAVLHA
NGIEVVQDIVLNHNDGAGSQTGGGGQDPAAWEDGSTSKYKNFRYVSYAKPATDETAANYL
ARNGRFPKNWQNFNPNPGNNSTSGDQNQILFGPDISYYNGSYGQSSNATFNPVQGADYMR
NNQRNWLVWYKKQEGFDGVRLDAVKHFPEFAMEDFLYNMQSNAGWANGGATMYAVGEWVG
GSGQMDSWVASVQNRAGTFDFSLRNALYSIVSGGGNFDIGSLPTYQQGTRVVQINGQFVH
RTVPFVNNHDTFRPQVGSTGNYTGWNTGSELAPHIDPFDPRLSAAYAAALAVDGSPQIFF
EDLFNIGNTGKRYSHQPTSTVDLPQRSDIENLIWCHQNLRFKDGAYKVRWQAQDHLVIER
STKAIIGVNDNFSTWQNSTISCDFAPGTVLKDYSGANGTATVTVSGSQTVSINTPPCNGT
ATGGRRGYSVWAPVGIGTNYVRAAMATTQEWELADDLGDSHASSLKQGGQLPASSTAYRT
AGRIYVESGKAVSYNLFPTDATRSLTVELVSGTSTIVSSKTGTGNLTGTYTPTATGWLTL
RAKNAVATNPAQRAFIKATYTAPAVLTSTALREATITASKEATVSGADLAVYPNPTASDR
IDVVVQSPKELTATLRLTDLLGRPVHEQAVRLYPGSTEQRLRVTRSLPAGVYLLSVPELN
LSRKVVVK
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atgtacaacggtacaaactcttggtggcgcaagctcaccctggctgcggctgcccttcta
gttctgggcggccaacccgccaaagcccaaaaagtagtcctgcagggctactggtgggac
tactggaacaccaactaccccaacggctgggccaactacattgccctgttggctccgcgc
ctgaaagccatgggcatcgacgccgtatggctcccgcccagcattaagaacggcaaccag
ggcaacggctactcgcccttcgacaactacgatctgggggataagtaccaaaaaggcttc
actgctacccgcctcggcaataaggacgaattgctgcgcgccgtggccgtgctgcacgcc
aacggcattgaggtggtgcaggacatcgtgctgaaccacaacgacggcgccggctcccag
accggcggcggcggccaggacccggccgcctgggaagatggctcgaccagcaagtacaag
aacttccggtacgtgagctacgccaagcccgccaccgacgaaacggccgccaactacctg
gcccgcaacggccgcttccccaaaaactggcagaacttcaaccccaaccccggtaacaac
tccacctccggcgaccagaaccagattctgttcggacccgatatcagctactataacggc
tcctacggccagagctccaacgccacgttcaacccggtgcagggcgccgactacatgcgc
aacaaccagcgcaactggctggtgtggtacaagaagcaggaaggctttgatggcgtgcgt
ctggatgccgtgaagcactttccggaatttgccatggaggatttcctctacaacatgcaa
agcaacgccggctgggccaacggcggtgccaccatgtacgccgtgggcgaatgggtaggc
ggcagcggccagatggacagctgggtggccagcgtgcagaaccgcgccggcaccttcgat
ttctcgctgcgcaacgccctatacagcatcgtgagcggcggcggcaactttgacatcggc
tcattgccgacttaccagcagggcacgcgggtggtgcagatcaatggacaattcgtacac
cgcacggtaccgttcgtgaacaaccacgacacgttccggccccaagtgggaagcaccggt
aactataccggctggaacaccggttcggaactggctccccacatcgacccgttcgacccg
cgcctctcggccgcgtatgctgccgcactggccgtggatggctcgccgcagattttcttc
gaggacctgttcaacatcggcaacacgggtaagcgctactcgcaccagcccaccagcacc
gtggacctgcctcagcgttccgacatcgagaacctgatctggtgccaccagaacctgcgc
ttcaaggacggcgcctacaaagtgcgctggcaagcccaggaccacctcgtaattgagcgg
agcaccaaggctatcatcggtgtcaacgacaacttctcgacctggcagaacagcacgatt
tcctgtgatttcgcgcccggcaccgtactcaaggactactctggggccaacggcacggct
accgtgacggtgagcggttcgcagacggtgagcatcaacacgccgccttgcaacggcacg
gccaccggcggccggcgtggctactcggtgtgggcaccggtgggcatcggcaccaactac
gtgcgcgccgctatggccaccacccaggaatgggaactggccgacgacctgggcgactcg
cacgcctcctcgctgaagcagggcgggcagctgccggcttcgtccactgcctaccgcacg
gcgggccgcatctacgtggaatcgggtaaggccgtctcgtataacctgttcccgacggat
gctacccgcagcctcaccgtggagctggtgagcggcacgagcaccattgtgagcagcaaa
accggcaccggcaacctcacgggcacttacacgcccaccgccaccggctggctgacgctg
cgcgccaaaaacgccgtggccaccaacccggcccagcgtgccttcatcaaggctacctac
accgccccggccgtactgacgagcaccgccctgcgcgaagccaccatcacggcctccaag
gaagccaccgtcagcggggccgacctagccgtgtaccccaaccccaccgcttctgaccgt
atcgacgtggtggtgcagtcgccgaaggagctgacggccacgctgcggctgacggacctg
ctgggccgcccggtacacgagcaggccgtgcgcctgtaccccggctccaccgagcagcgc
ctgcgcgtaacgcgcagcctgcccgccggcgtgtacctgctgagcgtacccgagctgaac
ctgagccggaaagtggtagtgaagtaa

DBGET integrated database retrieval system