KEGG   Hydrogenobacter thermophilus: Hydth_0078Help
Entry
Hydth_0078        CDS       T02106                                 

Definition
acetate/CoA ligase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hte  Hydrogenobacter thermophilus
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hte00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hydth_0078
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hydth_0078
   00620 Pyruvate metabolism
    Hydth_0078
   00640 Propanoate metabolism
    Hydth_0078
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Hydth_0078
   00680 Methane metabolism
    Hydth_0078
Enzymes [BR:hte01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Hydth_0078
Lipid biosynthesis proteins [BR:hte01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Hydth_0078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
79626..81521
Genome map
AA seq 631 aa AA seqDB search
MVEDRSETLLKVEEKYMPPPSIVESAWVRDYETLYQESIKDREAFWAKVAEDLHWFKKWD
KVLEWNYPYAKWFVGGKTNITYNCLDRHVKNGKRNKVAYIALDEDSREKKITYGELLELV
NRIANGLKSLGVKKGDRVSIYMPNTVEAVACMLACARIGAIHSLVFAGFSEGALRLRIED
AKAKVVITASYTKRRGKKIDLLATAQRAIDGLDFVEKVIVWDRDGDVLNGEDKFFVSLDE
LISTSSPKCEPEVMDAEDPLYILYTSGTTGKPKGVLHTTGGYMVGTYYTTKVVFDLKEDD
IYWCTADIGWVTGHSYIVYGPLAVGATSLIVEGAPDYPDPGRWWSYVEKYRVNIFYTAPT
AVRMFMKYGEQWPAKYDLSSLRILGSVGEPINPEAWHWYFKNIGREKCVIVDTWWQTETG
MHMITTIPSYPAKPGKAGKPFFGIEALVVDRHGNVLPPNTIGNLVIKTPWPSMLRTCWGE
PERYEKYWNTIPGYYLTGDLASYDEEGYIMILGRADDVLNVAGHRIGTMEVESAIVDYPA
VAEAAVIGKPHEVKGESIKAFVILKKGYEPSEKLVEEIKYHVKQVLGPIAVPDEIEFVEK
LPKTRSGKIMRRVLKAQELGLPVGDISTLED
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atggtggaagataggtctgagacacttttaaaagttgaggaaaagtacatgcctcctccg
tctatagtagagtccgcatgggtgagggattatgaaaccctataccaggaatccattaag
gacagagaagctttctgggcaaaggttgcggaggacctgcactggtttaaaaagtgggat
aaggttttggaatggaactatccatatgccaagtggttcgtaggaggaaaaactaacata
acttataactgccttgacaggcatgtaaaaaatggcaagaggaataaggtagcctacata
gcccttgatgaggacagcagggaaaagaaaattacttatggagagcttttggaacttgta
aatcgtatagccaacggacttaagtctcttggagttaaaaagggtgatagggtttccata
tacatgcctaatacggtagaagcagttgcatgtatgttggcatgtgcaaggataggagct
atacacagtctggtttttgcaggctttagtgaaggtgctttgaggctcaggatagaggat
gcaaaagcaaaggtggttataacagcaagttatactaagagaaggggtaaaaagatagac
ctgcttgcaactgcacagagggcaatagatggtcttgactttgtagaaaaagttatagtt
tgggacagggatggcgatgtgctaaatggggaggacaagttctttgtgagtcttgatgag
cttataagcaccagctcacccaagtgcgagccagaagttatggacgctgaggaccctctt
tacatactttacacatctggaactacaggcaagccaaagggtgtgctacacaccacaggt
ggctacatggtgggaacatactacaccacaaaggtggtttttgacctcaaagaggatgat
atatactggtgtaccgcagatataggctgggtgacaggacacagctacatagtgtatggt
ccacttgctgtgggtgccacatctctaatagtggaaggagcacccgattaccctgacccg
ggaaggtggtggagctatgtagaaaagtacagagttaacatcttttacaccgcgcctacg
gcggtaagaatgtttatgaagtacggtgagcagtggcctgccaagtatgacctctcttcg
ctgaggatattgggctcggttggtgaacccataaacccggaagcgtggcactggtacttt
aagaacataggaagagaaaagtgcgtcatagtggacacctggtggcagacagaaacaggc
atgcacatgataaccaccataccttcttaccctgcaaaaccgggtaaggcaggcaaaccc
ttctttggcatagaggctcttgtagtggacagacacgggaatgtcctcccccccaacacc
ataggcaacctcgttataaaaacaccctggccttctatgctcagaacctgctggggagag
ccagagaggtacgaaaagtactggaacaccatacccggatactatctgacaggagaccta
gcttcttatgacgaggagggatacataatgattctgggaagggctgacgatgtgctaaat
gttgcaggacacaggataggaactatggaagtggaaagcgccatagtggactatcctgct
gtggctgaagctgcagttatcggaaaaccccacgaggttaagggagaatctataaaggct
tttgtgatactcaagaagggttatgagccatctgaaaagctcgttgaggaaataaagtac
catgtgaagcaggtgctgggacctatagcggtgcctgacgagatagagtttgttgaaaag
cttcccaagaccagaagcggaaagataatgagaagagttctaaaggctcaggagcttggg
cttccggttggagacatatccacccttgaggactga

DBGET integrated database retrieval system