KEGG   Hydrogenobacter thermophilus: Hydth_0110Help
Entry
Hydth_0110        CDS       T02106                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
hte  Hydrogenobacter thermophilus
Pathway
hte00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hte01100  Metabolic pathways
hte01110  Biosynthesis of secondary metabolites
hte01130  Biosynthesis of antibiotics
hte01230  Biosynthesis of amino acids
Module
hte_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hte00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Hydth_0110
Enzymes [BR:hte01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Hydth_0110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE SOR_SNZ FMN_dh His_biosynth ThiG QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ADO44520
UniProt: D3DFH4
Position
complement(113938..114717)
Genome map
AA seq 259 aa AA seqDB search
MGFLKEILERKRQEVKKTRELIKNLPLTPKRERSLAFEDALCGKGTKIIAEVKKASPSEG
KIREVSAWHQAKIYESAGAVAVSVLTDSTYFDGSLEDLYQVRRTVNIPILRKDFIIDTVQ
IEEARAFGADAVLLIVRILEPSLLKDLIEYSYALSITPLVEVFDLKEAEIALRAGAKVIG
INNRDLDTLKVDTELSKRLTPLLKQMGAKYVIAESGISEREQILELESLGADAFLVGTAL
MKSQDPAKKLRELLGYNDV
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgggatttctcaaagagatattggaacgcaaaaggcaggaggtaaagaagacaagagag
cttatcaaaaacctccctttgactcccaaaagggagagaagtttggcatttgaagatgcg
ctctgtggcaaaggcacaaaaataatagcggaagttaaaaaggcttctccatccgaggga
aaaataagagaagtttcggcttggcatcaggctaagatatacgagagtgctggcgctgtt
gccgtttcggtgcttacagacagcacttactttgatggctctcttgaagacctatatcag
gtaagaagaactgtaaacatacccatcctgaggaaagactttatcatagacactgtgcag
atagaagaagccagagcttttggtgcggatgctgtccttttgatagtccgcattcttgag
ccatccttacttaaagaccttattgaatactcttatgcgctgtctattacaccccttgtg
gaagtttttgacctcaaagaagctgaaatagccctaagagccggtgcaaaagttattggc
ataaacaacagggaccttgacaccctaaaagtggacacagagctctccaagagactcaca
cctctattaaagcagatgggtgctaagtacgtaatagcagaaagcggtataagtgagagg
gagcaaatacttgaacttgaaagcttaggtgctgatgcctttttggtggggactgccctc
atgaagagccaagacccagcaaaaaaactcagggagcttttgggttataatgatgtttaa

DBGET integrated database retrieval system