KEGG   Hydrogenobacter thermophilus: Hydth_0114Help
Entry
Hydth_0114        CDS       T02106                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritolkinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
hte  Hydrogenobacter thermophilus
Pathway
hte00900  Terpenoid backbone biosynthesis
hte01100  Metabolic pathways
hte01110  Biosynthesis of secondary metabolites
hte01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hte00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Hydth_0114
Enzymes [BR:hte01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Hydth_0114
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ADO44524
UniProt: D3DFH8
Position
118427..119239
Genome map
AA seq 270 aa AA seqDB search
MRVLSPAKVNLGLWLLGRRADGYHEIFTIYQAVSLFDEIFIKEGPLKVETSSLIPQEKNL
VYKALRLMEKYLGRDIDFSIYIKKNIPEGAGLGGGSSNCATVLKVVNQLLGEPLSVEDLE
NIAKEVSSDAVFFLYGGTAVGRGRGDVVEPIKHLDLKITLVYPNVVASTRRVYSAVRDAS
LTDKIEDDKIISCLLEGKFEVLENTLGQVAMELFPEIKEAYRFLEYLGYRPVVSGSGSCV
FYIGEASEQVKKGAALRGWRLYEVKSYNGV
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgttttgtctccagctaaggtaaacctcggtctgtggcttttaggaaggagagct
gatggttatcacgaaatattcaccatataccaagctgtatcactttttgacgagattttc
ataaaggagggtccgctaaaggtagaaaccagcagcttaataccacaggaaaagaactta
gtatacaaagccctcaggcttatggagaaatacttgggaagagatatagattttagcata
tacattaaaaagaacattcctgaaggtgcgggtcttggtggtggttcttccaactgtgct
actgtgctaaaggtggtaaaccagctactgggtgaacctttaagtgttgaggacctggaa
aacatagcaaaagaagtatcctctgatgctgtcttcttcctttatgggggtacagcggta
ggcagaggtaggggtgatgtggtagaacctattaaacaccttgacttaaaaattacattg
gtttatcccaatgtagtggcctctacacgcagagtctatagtgcggtaagggatgcatca
ttgacagataaaattgaagatgataaaataataagctgtctcttagaaggtaagtttgag
gtgctggagaataccctggggcaggtggctatggagctgtttccggagataaaggaagct
tacaggtttttagagtatttgggctacagacctgtggtgagcggtagcgggtcatgcgta
ttttatataggtgaagcgtctgagcaagtaaagaagggtgctgctcttagaggatggcgc
ttatatgaggtcaaaagctataatggggtgtag

DBGET integrated database retrieval system