KEGG   Hydrogenobacter thermophilus: Hydth_0166Help
Entry
Hydth_0166        CDS       T02106                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
hte  Hydrogenobacter thermophilus
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:hte00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
170945..171586
Genome map
AA seq 213 aa AA seqDB search
MGCLFVLSAPSGAGKTTVAEKLIREVSGIKRVVTATTRSKREGEREGVDYIFMSREEFER
GIKDSIFLEYASVYGNYYGTPKEQVKKVLEEGFDALLVIDVQGAKSIKDKLPESILIFLL
PPSLEELKRRLITRGYAEENLLEREKKVEVEIACARHFDYIVVNDFLDKAVEAIKHIVNS
YRHTKERVFKDIEKLVKDDTIKDILLKGRCDIF
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgggttgtctttttgttctctcagcaccatctggagcaggcaaaaccactgtggcggaa
aagctcatcagagaagtttctggtattaaaagggtggtgactgcaacaacaagatcaaaa
agggaaggagagagagaaggtgtggactatattttcatgagcagggaggagtttgagagg
ggtataaaggatagcattttccttgagtatgcctccgtgtatggcaattactacggcact
ccaaaggagcaggtaaaaaaggtgttagaggagggttttgacgctcttctggttatagat
gtgcaaggtgcaaagagcataaaggataaactcccggaaagtattcttattttccttctg
cctccatctcttgaggaactaaagaggcgtctcatcacacgagggtatgcggaggaaaac
cttctggagagggagaagaaagtggaagtagaaatagcctgtgccaggcactttgattac
atagtggtcaacgattttcttgacaaggctgtggaagccataaagcacatagtaaattct
tacagacacacaaaggagagggtgtttaaagacatagaaaagctcgtcaaagatgatact
ataaaggatatactgctcaaaggcaggtgtgatatcttttaa

DBGET integrated database retrieval system