KEGG   Hydrogenobacter thermophilus: Hydth_0272Help
Entry
Hydth_0272        CDS       T02106                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
hte  Hydrogenobacter thermophilus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hte00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Hydth_0272
Enzymes [BR:hte01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Hydth_0272
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(277949..279379)
Genome map
AA seq 476 aa AA seqDB search
MRLAGILLHITSLPSSFGVGDLGPTAYEFVDFLEASGQKLWQILPLNPTCMEFGNSPYFS
ISLFAGNPLLISLELLCKEGLLSDKDIQRAKFQSDRVDYERASRIKMELLEKAFSNFSQT
PEYLSFEEENGYWLEDYCRFKVLRDRFKKPWREWESESVKELELQIKKEKFFQFLFFKQW
KTLKAYANSKEIRIMGDLPIYPAFDSSDVWSHRDLFKLDENNMPYVVAGVPPDYFSPTGQ
LWGNPVYNWDRLKETGFHWWIERIRHNLKLFDLLRLDHFRGFVAYYEVPASEKTAIVGRW
VNAPAEEFFAKLKREFPDFPFVAEDLGLITPDVERIRDSFGFPGMKVLAFAFEEDNHPFM
PHNHQKNSFVYTGTHDNAPIRSWFLEELSSASKERLFRYLGRAVDEEQVSDVLIRLAYMS
VAKACVIPMQDILNLGKEARMNTPGKKEGNWEWKLKSIPDEKVAQRLRELCTTYGR
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
gtgaggttggcaggtatacttttgcatataacttctcttccctcatcctttggggtcgga
gaccttggtcctaccgcttatgagtttgtggattttttggaagcttcgggacagaagctt
tggcagatacttcctctgaaccccacctgcatggagtttggaaactctccctactttagc
atatctctatttgcaggcaacccattgcttataagtcttgaacttctttgcaaagaaggg
cttctctcagataaggatattcagagagctaagttccaaagtgatagggtggattatgag
agggcatcaaggataaagatggagcttctggagaaggcttttagtaattttagtcaaacg
cctgagtatctgtcttttgaagaagaaaacggctactggcttgaggattactgcaggttt
aaggttctcagagacaggtttaaaaaaccttggagagagtgggaaagtgagagtgtaaaa
gagcttgaacttcagataaagaaagaaaagttttttcagtttttgtttttcaaacagtgg
aaaactcttaaagcttacgccaattctaaagagataaggataatgggagaccttcccatc
tatcctgcctttgacagcagtgatgtgtggtctcacagggaccttttcaagcttgatgaa
aacaatatgccatatgtggtggcaggcgttccacccgattactttagtcccacaggtcag
ctctggggaaatcctgtttataactgggacaggctgaaggaaacagggtttcattggtgg
atagagaggattaggcataacctaaagctctttgaccttttaagacttgaccacttcagg
ggttttgtggcttactacgaggtgccagcttctgaaaaaacggctatagtaggcaggtgg
gtgaatgctcctgcggaagagtttttcgcaaagctaaagagagagtttcctgactttcct
tttgttgcagaggaccttgggcttataacgccagatgtggaaagaatcagggacagcttt
ggttttccgggtatgaaggtgcttgcctttgcttttgaggaggataaccatccctttatg
cctcacaatcaccagaaaaattccttcgtttacacaggcactcacgacaatgcacccata
aggtcctggtttttggaggagctaagcagtgcttcaaaggagagactctttagatacctg
ggaagagcagttgatgaagagcaggtaagtgatgttcttataaggcttgcttacatgtcc
gtggctaaagcttgcgtgattcctatgcaggatattctcaatcttggtaaagaggcaaga
atgaacacaccgggaaagaaagaaggcaattgggagtggaaactaaaaagcatacccgat
gaaaaggtagcgcagagactaagagagctttgcaccacctatggaaggtaa

DBGET integrated database retrieval system