KEGG   Hydrogenobacter thermophilus: Hydth_0331Help
Entry
Hydth_0331        CDS       T02106                                 

Definition
nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
hte  Hydrogenobacter thermophilus
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:hte00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(336925..337512)
Genome map
AA seq 195 aa AA seqDB search
MRVKLTDKDALIVVDMQNDFMPWGALPVPDGDKIVPKLNAYIDIFSSRGLPVYFTRDWHP
PDHISFLENGGVWPPHCVQNTEGAKFHKDLRIPKDNKFIISKGTSRDFDAYSGFQGTMLD
SLLQERGIRRVFVGGVATDYCVKNTVMGALNLEYQAFLLIDATKGVDVKPGDTERAIDEM
LSSGAVAIEFENLTA
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgagagtaaaattgacggataaggatgcactcatagtagtagatatgcaaaacgatttt
atgccttggggtgcattgccagtaccagatggcgacaagatagtgcctaagctcaacgct
tatatagatattttctcttcaagagggcttcctgtttattttacgagggattggcatccc
cccgatcacatctcttttttagaaaatggtggagtgtggccaccccactgcgttcaaaat
accgaaggagctaagtttcataaagatctacgcataccaaaagataacaagtttatcata
tccaagggaaccagtagggactttgacgcttattcgggctttcagggaactatgctagac
agtttactccaagagagaggcataaggagggtttttgtaggaggtgtggcaacggattac
tgtgtgaaaaatacggtgatgggagcccttaacttggaatatcaggcatttcttcttatt
gatgctacaaaaggtgtggatgtaaaacctggtgatacagaaagagcaatagatgagatg
ctaagctcaggtgctgtagccattgagtttgaaaacttgactgcgtaa

DBGET integrated database retrieval system