KEGG   Hydrogenobacter thermophilus: Hydth_0481Help
Entry
Hydth_0481        CDS       T02106                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
hte  Hydrogenobacter thermophilus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:hte00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
475151..476137
Genome map
AA seq 328 aa AA seqDB search
MEFPKLRPRRLRSNESIRRLVRETKLSLDDLICPVFVRYGEGIEEEVPSMPGVFRYSPDK
VIDEVKKIRDLGIPAIILFGIPEHKDEVGSDTWSKEGIIQRTVRLIKKEVPDIYVITDVC
FCEYTTHGHCGVLKNHHVDNDATLENLKKQAVSHAESGADMLAPSGMMDGMVKAIRSALD
EANFYEIPIMAYSAKFASAFYGPFRDAAQSAPAFGDRRTYQMDPSNAREALKEVLLDLQE
GADIVMVKPALSYLDIIYRVKEATLLPVCAYNVSGEYSMIKAAGKLGWIDERKVMWEVLT
SIKRAGADMIITYFAKDVAILINRGELA
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggagtttccaaagctaagacctcgcaggctgaggagtaatgagagcataaggcgtttg
gttagagagaccaagctgagtcttgacgaccttatatgccctgtttttgtgcgctacgga
gagggtattgaagaagaagtgccttctatgccgggagttttcagatacagtcccgacaaa
gtgattgatgaagttaaaaagataagggatttgggcattcctgccataatactctttggt
attccagagcacaaggacgaggttggatcagatacatggagcaaagaaggtataatccag
aggactgtaaggcttataaaaaaagaggtaccagacatttatgtaattacggatgtgtgc
ttctgtgagtacaccacccatggacactgcggagtgctcaaaaaccaccacgttgacaac
gatgctacgcttgaaaatctcaaaaaacaagctgtatctcatgcagaaagcggggctgat
atgctggcaccttctggtatgatggacggtatggtaaaagctataaggagtgctttagat
gaggctaacttttatgagattcccataatggcatactctgccaagtttgcctctgccttt
tacggacccttcagagatgctgcgcagtcagcaccagcctttggcgatagaagaacttac
cagatggacccgtccaacgcaagagaagccttaaaggaagtgcttttggaccttcaagaa
ggtgcagacatagttatggtaaagccagccctatcttacttggatattatttaccgcgta
aaggaggctacactgcttccagtatgcgcttacaatgtgagcggtgagtattctatgata
aaggcagccggaaagcttggatggatagacgaaaggaaagttatgtgggaggtgctaact
tctataaagcgtgctggtgcggatatgatcatcacttactttgctaaagatgtggctatt
ttaataaacagaggtgagttggcatga

DBGET integrated database retrieval system