KEGG   Hydrogenobacter thermophilus: Hydth_0597Help
Entry
Hydth_0597        CDS       T02106                                 

Definition
glutamyl-tRNA synthetase (EC:6.1.1.17)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
hte  Hydrogenobacter thermophilus
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:hte00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    Hydth_0597
Enzymes [BR:hte01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     Hydth_0597
Amino acid related enzymes [BR:hte01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   Hydth_0597
Transfer RNA biogenesis [BR:hte03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Hydth_0597
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
562537..563949
Genome map
AA seq 470 aa AA seqDB search
MVITRFAPSPTGYLHLGNARTAIFSYLFARHHRGKFILRIEDTDLERSTKEFEAMLLEDL
KWLGLDWDEFYRQSERFDIYREYAQRLIELGHAYPCFCTPEELSIERQEAEKKGIPYRYS
GKCRVLDKKQVEELKESGKSYTIRFKVPYGEYVVFEDLIKGHIAINTDDFGDFVIIRSDG
TPTYNFVVVIDDALMGITHVIRGEDHIPNTPKQILIYRALGFDVPKFAHLPVILGEDRSK
LSKRHGAVSVRNYREEGYLPQALFNYLCLLGWSSPQEGKEIYSKEELIEIFDLKDINTSP
AVFSKEKLRWMNGVYIREVLSLEELIDGITPFLKQAGYDVSDRDYLKRVLEKTRDSFETF
KEAGDRLKPFFVDDFDISQDAWSELENARVYDILSVFLEKIKDRQLNAQSVKEMAREIQK
ELNVKAKDVWHSLRIALTGELEGVGVDILCDILPKEKIVLRVERLLKKIA
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggtaatcacaaggtttgccccaagtccaacaggatacctgcacttgggtaatgcaagg
acggccatttttagctacctctttgcacgccaccacagaggaaagttcatacttagaata
gaagacacagatttagaaaggtctacaaaagagtttgaggctatgctccttgaagacctc
aaatggctgggtcttgattgggacgaattttacagacagtccgagaggtttgacatttac
agagagtatgcacaaagactcatagagttaggacacgcatatccatgcttttgcactcca
gaagagctaagcatagaaagacaagaggctgaaaagaaaggcataccttacagatactcg
ggaaaatgcagagttctggataagaagcaggtggaggagctaaaagaaagtggcaaatct
tacactatacgctttaaggtgccttacggagagtacgtagtctttgaagacctcataaag
ggacacatagccataaacaccgatgactttggggactttgtgataataagaagcgatgga
acacctacctataactttgtggtagttattgacgatgcactcatggggataacgcatgta
ataaggggagaggaccacatacccaacacacccaaacagatactaatatacagggcgctt
ggctttgatgtgcctaagtttgcgcacctgcctgtcatactcggtgaagacaggagcaag
ctttccaaaaggcatggagcggtttctgtaagaaactacagagaggagggataccttccc
caagcgctttttaattacctgtgtcttttaggttggtcttcaccccaagaaggcaaagaa
atatacagcaaggaggagctcatagaaatatttgacctaaaagacataaacacatcccca
gccgttttcagcaaagaaaaactcagatggatgaatggagtttacataagagaagtgcta
agcctggaggagctaatagatggaataacacctttcttaaagcaagcgggttatgatgtt
agcgacagagattatcttaaaagggtgcttgaaaagacaagagactcctttgaaaccttt
aaggaagctggtgatagactaaaacccttctttgttgatgattttgatatatctcaggat
gcatggagcgagcttgaaaatgcaagggtgtacgatatactctctgtattcttagagaag
ataaaagataggcaacttaatgcccagagtgtaaaggagatggccagagaaatacaaaag
gagcttaatgtaaaagctaaggatgtgtggcactctctcaggatagccctaacaggtgag
ctggaaggtgtaggcgtagacatactttgcgatatcctgcctaaggagaagatagtattg
agggtggagcgtctccttaaaaagatagcatga

DBGET integrated database retrieval system