KEGG   Hydrogenobacter thermophilus: Hydth_0599Help
Entry
Hydth_0599        CDS       T02106                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hte  Hydrogenobacter thermophilus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hte00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Hydth_0599
   00052 Galactose metabolism
    Hydth_0599
   00500 Starch and sucrose metabolism
    Hydth_0599
   00520 Amino sugar and nucleotide sugar metabolism
    Hydth_0599
Enzymes [BR:hte01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Hydth_0599
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
565051..565941
Genome map
AA seq 296 aa AA seqDB search
MQVRKAVLPVAGWGTRFLPATKAMPKEMFPIIDKPVIQFIVEECISADIENIIFVTGRHK
RPIEHHFDINTDLEKHLEQCGKMDLLRNIMEISRLINPIYVRQKEQLGLGHAVLVAEPVV
GYEPFVVALGDIIIKDERNVLERMIEVYNRFGKSVIAVFEVDLKDVSKYGIVDGRLIERD
IYIVDHLIEKPKPEEAPSHLAIVGRYLFTPRIFEKLKITPPGKGGEIQLTDAIRLLIEDE
AVYAIKIDAKVYDTGTPLGYIQTVLDFALQRDDIRDDLISYLRQLLSNNIPQIDTV
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtaagaaaggcggtcttacctgtagcaggttggggcacaaggtttttacctgcc
accaaggctatgcccaaggagatgtttccaataatagacaagcctgtcatacagtttatc
gttgaagaatgcatctctgcagacattgagaacattatattcgtcacagggaggcataaa
aggcccattgaacaccactttgatataaacacagatttggaaaagcatctagaacagtgt
ggaaagatggaccttttgaggaacataatggaaataagtaggttgattaatcccatatat
gtaagacagaaggaacagcttggacttggtcatgcagtattggtagctgaacccgtggta
ggctatgaaccttttgtggtagctcttggggatatcatcatcaaggatgagaggaacgta
cttgagagaatgatagaagtatacaaccgctttggtaagagtgtaatagcagtttttgaa
gtggaccttaaggatgtttccaagtacggtatagtagacggcagacttatagagagggat
atatacattgtagaccatcttatagaaaaaccaaagccagaggaggcaccctctcatctt
gccatagtaggcaggtacctttttacaccgaggatctttgaaaaacttaaaataacacct
cccggaaagggcggagagatacagctcaccgatgctataaggttgcttattgaggacgaa
gctgtttatgcaatcaagatagatgctaaggtttacgatacgggaacacctctcggatat
atacagacggtccttgactttgctttgcaaagagatgacatcagagatgacctcatatct
tacttgaggcagctcctcagtaataatatcccacagatagatacagtctga

  All links  
No link information was found.   
DBGET integrated database retrieval system