KEGG   Hydrogenobacter thermophilus: Hydth_0610Help
Entry
Hydth_0610        CDS       T02106                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hte  Hydrogenobacter thermophilus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hte00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hydth_0610
   01230 Biosynthesis of amino acids
    Hydth_0610
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hydth_0610
   00051 Fructose and mannose metabolism
    Hydth_0610
   00562 Inositol phosphate metabolism
    Hydth_0610
Enzymes [BR:hte01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Hydth_0610
Exosome [BR:hte04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Hydth_0610
  Exosomal proteins of bladder cancer cells
   Hydth_0610
  Exosomal proteins of melanoma cells
   Hydth_0610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(577600..578340)
Genome map
AA seq 246 aa AA seqDB search
MKLISANWKMNMTPSQTKEYLYNFLPLVEDVKDREILLCVPYTSLCIASEMLKDKHVKFG
AQNVHYEPKGAFTGEISVSMLKDLGVSYVIVGHSERRWLFGESDEIINKKLIACLGSGIR
PILCVGERQDEREAGLTFKVIETQVKLALSSLEDYTDMIDIAYEPVWAIGSGNPATPEDA
QKVHRFIKELLESLNKNYKGTTRILYGGSVNIHNASEFMKMPDIDGLLVGGASLDPEAFS
QIVKSF
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcatctctgccaactggaaaatgaatatgaccccttctcagaccaaagagtat
ctgtataactttttaccacttgttgaagatgtaaaagacagggagatacttctgtgcgtg
ccatacacttctctgtgtattgcttctgaaatgcttaaagataaacatgtaaagtttggc
gctcaaaatgtgcattatgaaccgaagggagcctttacaggagagatatcggtcagtatg
ctcaaggacttgggggtgtcttatgtaatagtgggtcattcagagagaaggtggcttttt
ggtgaaagtgatgaaataatcaacaaaaagttaatagcttgtcttggcagtggtataaga
cccatactttgcgttggggaaaggcaggacgagagggaggcagggctcacctttaaggta
attgagacgcaggttaaacttgcgctgtcttctctggaagactatacggatatgatagac
atagcctacgagcctgtttgggcaatagggagtgggaatcccgccacacccgaggatgca
cagaaggttcacagatttataaaagaactacttgaaagcttaaacaaaaattataaaggt
actacacgcattctttacggtggaagcgtaaacatccataatgccagtgagttcatgaag
atgccggacatagacgggcttttggtaggtggtgccagcttagaccctgaagccttttcc
cagatagtaaagtccttttag

DBGET integrated database retrieval system