KEGG   Hydrogenobacter thermophilus: Hydth_1059Help
Entry
Hydth_1059        CDS       T02106                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hte  Hydrogenobacter thermophilus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hte00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Hydth_1059
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hydth_1059
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Hydth_1059
Enzymes [BR:hte01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Hydth_1059
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
974710..976008
Genome map
AA seq 432 aa AA seqDB search
MKILLSEEEIPKSWFNITPYLPKPLEPPLDPQTKEPVSPDKLLAIFPEPIVEQEVSEKEW
IEVPEDVLRVYSLWRPTPLHRAKNLEEYLQTPAKIFYKNESVSPPGSHKPNTAVAQAYYN
KVSGVKRLTTETGAGQWGSSLAFATQFFNLECEVYMVRVSYNQKPFRRILMETWGAKVIP
SPSPYTRAGRKFYEENPEHPGSLGIAISEAIEKALTSSDTKYSLGSVLNHVLLHQTVIGL
EAKKQMEKAGYYPDYVVGAVGGGSNFAGLAFPFLKDKLTGEKPHLEVIAVEPEACPTLTK
GEYRYDYGDTVGLTPLIKMHTLGHEFVPPPIHAGGLRYHGDAPLLCLLYHEGYISASAYK
QRAVFEAAITFARTEGIVPAPESAHAIRKAIDIALECKERGEEKVILFNLSGHGYFDLSA
YDMYLKGELPDT
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgaagatactgctatcggaggaggagataccaaaaagctggtttaatatcactccgtat
ttaccaaaacctctggagcctcctctggacccccaaacaaaagagccagtcagtccggac
aaactccttgccatatttccagagcctatagtggagcaggaggtttctgaaaaagagtgg
atagaagtgccagaggatgttctaagggtatactccctctggagaccaacaccccttcac
agggcaaagaaccttgaagagtaccttcagacacctgccaagatcttttacaaaaacgag
agcgtctcaccacccggaagccacaagccaaatactgcggtggctcaagcttactacaac
aaggtttcaggagttaaaaggctcaccacagagacgggtgcaggtcagtggggaagctcc
ttagcctttgccactcagttctttaaccttgaatgtgaagtttatatggtaagagtaagt
tataaccaaaagcctttcagaagaatacttatggaaacatggggagctaaagtaatccca
tcacccagcccttacactcgggcgggcaggaagttttacgaagagaacccagagcatcct
gggagtctcggtatagccataagtgaagctatagaaaaagctcttacctcttcggacacc
aagtactctcttggtagcgtcctaaaccatgtgcttttgcatcaaacggtaataggtctt
gaggcaaaaaaacagatggaaaaagcaggatactatcctgactatgtggtgggcgcggtc
ggtggtggtagcaactttgcagggcttgcctttcccttcctgaaggacaaactcacaggt
gaaaagccccaccttgaggtcatagcggtagagccagaagcctgccctaccttaacaaag
ggtgagtacagatacgactacggagatactgtaggcttgacgcctctgatcaagatgcac
accctcggacacgaatttgttcccccacctatacacgctggaggacttcggtatcacgga
gatgcccctcttttatgcctgctctaccatgaaggttatatatccgcatccgcctataag
cagagagctgtttttgaggctgctattacctttgcaagaacggaaggcatagttcccgcg
ccagaatcagcccacgccataagaaaagccatagacatagctttggagtgcaaagaaaga
ggagaagagaaggtgatactctttaacctatccgggcacggctactttgacctctccgcc
tatgatatgtacctgaagggtgaactgcctgacacttaa

DBGET integrated database retrieval system