KEGG   Hydrogenobacter thermophilus: Hydth_1090Help
Entry
Hydth_1090        CDS       T02106                                 

Definition
(GenBank) ferredoxin
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
hte  Hydrogenobacter thermophilus
Pathway
hte00010  Glycolysis / Gluconeogenesis
hte00020  Citrate cycle (TCA cycle)
hte00620  Pyruvate metabolism
hte00633  Nitrotoluene degradation
hte00640  Propanoate metabolism
hte00650  Butanoate metabolism
hte00680  Methane metabolism
hte00720  Carbon fixation pathways in prokaryotes
hte01100  Metabolic pathways
hte01120  Microbial metabolism in diverse environments
hte01130  Biosynthesis of antibiotics
hte01200  Carbon metabolism
Module
hte_M00173  Reductive citrate cycle (Arnon-Buchanan cycle)
hte_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hte00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hydth_1090
   00020 Citrate cycle (TCA cycle)
    Hydth_1090
   00620 Pyruvate metabolism
    Hydth_1090
   00640 Propanoate metabolism
    Hydth_1090
   00650 Butanoate metabolism
    Hydth_1090
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Hydth_1090
   00680 Methane metabolism
    Hydth_1090
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Hydth_1090
Enzymes [BR:hte01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Hydth_1090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_21 Fer4_2 Fer4_10 Fer4 Fer4_6 Fer4_9 Fer4_4 Fer4_13 Fer4_15 Fer4_7 Fer4_16
Motif
Other DBs
NCBI-ProteinID: ADO45483
UniProt: D3DIA4
Position
1002973..1003197
Genome map
AA seq 74 aa AA seqDB search
MYYVADVNETDCAKYNCKQCVLFCPEPNTLMYHDSKHVAWVNYSRCKGCAICVYVCSDLL
KRNCIQMVMVTAGD
NT seq 225 nt NT seq  +upstreamnt  +downstreamnt
atgtactatgtggctgatgtaaacgaaacagactgcgccaaatataactgcaagcagtgc
gtgcttttctgtcctgagcctaacacgcttatgtaccacgactccaagcatgtggcttgg
gtcaattactccagatgtaaaggctgtgccatatgtgtgtatgtgtgttctgacctcctc
aaaagaaactgcatacagatggttatggtgactgcaggagactga

DBGET integrated database retrieval system