KEGG   Hydrogenobacter thermophilus: Hydth_1090Help
Entry
Hydth_1090        CDS       T02106                                 

Definition
ferredoxin
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
hte  Hydrogenobacter thermophilus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive citrate cycle (Arnon-Buchanan cycle)
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hte00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hydth_1090
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hydth_1090
   00020 Citrate cycle (TCA cycle)
    Hydth_1090
   00620 Pyruvate metabolism
    Hydth_1090
   00640 Propanoate metabolism
    Hydth_1090
   00650 Butanoate metabolism
    Hydth_1090
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Hydth_1090
   00680 Methane metabolism
    Hydth_1090
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Hydth_1090
Enzymes [BR:hte01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Hydth_1090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1002973..1003197
Genome map
AA seq 74 aa AA seqDB search
MYYVADVNETDCAKYNCKQCVLFCPEPNTLMYHDSKHVAWVNYSRCKGCAICVYVCSDLL
KRNCIQMVMVTAGD
NT seq 225 nt NT seq  +upstreamnt  +downstreamnt
atgtactatgtggctgatgtaaacgaaacagactgcgccaaatataactgcaagcagtgc
gtgcttttctgtcctgagcctaacacgcttatgtaccacgactccaagcatgtggcttgg
gtcaattactccagatgtaaaggctgtgccatatgtgtgtatgtgtgttctgacctcctc
aaaagaaactgcatacagatggttatggtgactgcaggagactga

DBGET integrated database retrieval system