KEGG   Hydrogenobacter thermophilus: Hydth_1096Help
Entry
Hydth_1096        CDS       T02106                                 

Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
hte  Hydrogenobacter thermophilus
Brite
Enzymes [BR:hte01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Hydth_1096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1010114..1011124
Genome map
AA seq 336 aa AA seqDB search
MRKSALLALLLVSGVYSKDGSDKDLLEKARQFFSPLPKSFPSEENPITPEKVKLGRLLFF
ERRLSVNDMISCATCHAVEYYYASPAPKQMGALKLQPRHAPTVLNSAGQFVQHWIGNRKD
VEDQALQSLTGPPALGNPSRESAEEKLKSIPAYVELFKKAFPKDKEPITAENIAKAIGAF
ERTLVTPSRFDEFLKGNTKALTEEEKKGLKTFIEVGCVSCHNGTLVGGTMYQKFGIYEPY
WKYTKSESIDEGRYAVTKKEEDKYVFKVPPLRNVAMTPPYFPDGSVTSLEEAVWIMGKVQ
LGKDLSKQQVRYIVAFLKSLTGRLPEEARKPPILPP
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagtcagcccttttggctttacttcttgtaagtggtgtatattcaaaagatggt
tcagataaagaccttctggagaaggcaaggcagttcttctccccactacccaagagcttc
ccatcggaggaaaaccccataacccctgagaaggtaaagcttggcaggcttctcttcttt
gagaggagactgtcggttaatgacatgataagctgcgccacctgccacgctgtagagtac
tattatgcatcccctgcacccaaacagatgggtgcgttaaagctccagcccagacacgca
ccaacagtgctcaactcagcgggacagtttgtccagcactggataggcaacaggaaggat
gtggaagaccaagccctccaatccctgaccggaccacccgccttgggaaatccctccagg
gaaagcgcggaagaaaagctaaaaagcatccctgcgtatgtggagcttttcaaaaaagca
tttccaaaggataaggagcctataaccgcagagaacatagcaaaagctataggagctttt
gaaagaacccttgtgactccttcaaggtttgacgagtttctcaaaggcaacaccaaagcg
ctaacggaagaggaaaagaagggtttgaaaacttttatagaagtagggtgtgtttcttgc
cacaacggcacccttgtggggggcaccatgtatcagaagtttggcatatacgaaccttac
tggaagtatacaaagagtgagagcatagacgaaggaaggtatgcagttactaaaaaggaa
gaagataagtatgtttttaaggtaccaccccttagaaatgtagccatgacaccaccgtat
tttcctgacgggtctgtcacaagccttgaagaagcggtgtggataatgggaaaggtccag
ctgggcaaagacctgagcaagcagcaggtaaggtacatagttgcttttctcaaaagttta
acgggcagactgcctgaagaagcgcgaaaaccgcctatcctcccaccgtaa

DBGET integrated database retrieval system