KEGG   Hydrogenobacter thermophilus: Hydth_1101Help
Entry
Hydth_1101        CDS       T02106                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
hte  Hydrogenobacter thermophilus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:hte00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1014872..1015654)
Genome map
AA seq 260 aa AA seqDB search
MKLKGKRIALCITRRVEEAIESIVKLGGKPYVEDVVRIVALPDEVIKENIKNAVFEAPEI
FYFTTGEGTDVLLKKSREIGLYEPLLKGKVFARGYKVRARLINYGFKNFQSVESTRAFMN
MLKDIEILNTKILVQMYGEEMHELEEFLNNKGAKMLKLWLYRYETDTERLDAFIIKLLEG
FYHAVLFTSAYQVDYIFKRAKEKNLGKNLSSSLNNKVFTVAVGRKTAGKLFENGVLRVYY
PEKERLTYALKELEIAFKDG
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgaagggtaaaaggatagctctatgtattacacgaagagtggaagaggctata
gaaagtatagtaaaactcggtggaaagccgtatgtagaagatgtggtcagaatagtggcg
ttgccagatgaagtaataaaggaaaatataaaaaacgcagtatttgaagcgccggagatt
ttttactttacaaccggtgaaggtacagacgtacttctaaaaaaatccagagaaatagga
ctctacgaacctctattaaaaggcaaagtttttgctaggggttataaggtgagggcaaga
ctgataaactatggttttaaaaattttcaaagcgtagaaagtactagggcttttatgaat
atgttaaaagacatagaaatactaaacactaagatacttgtgcagatgtacggggaggag
atgcatgaacttgaagagtttttaaacaataagggggcaaaaatgctaaagctctggctt
tacagatacgagacggatacagaaaggcttgatgcttttataataaagcttttggaaggc
ttttatcacgctgtgcttttcacctcagcctatcaagtggattatatctttaagagagct
aaagaaaagaatttaggtaaaaatctctcaagctctctaaacaataaggtattcaccgtt
gctgtaggaagaaagacggcgggtaagctttttgagaacggggttctgagggtttactat
ccagaaaaggagagactcacttacgctctgaaagagctggagatagcttttaaagatggg
taa

DBGET integrated database retrieval system