KEGG   Hydrogenobacter thermophilus: Hydth_1190Help
Entry
Hydth_1190        CDS       T02106                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
hte  Hydrogenobacter thermophilus
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:hte00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Hydth_1190
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Hydth_1190
Enzymes [BR:hte01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Hydth_1190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1087103..1088494)
Genome map
AA seq 463 aa AA seqDB search
MKLFEDVKGITDNSKEVKEGYIFVAIKGSQNDGHNFVKEALSRGAKWVLVEKDVGITDNR
IVKVKDTREALGELVSAFYGKPSKKLKVIGITGTNGKTTTTHIVEALLNAGGIKTGLVGT
IYYRLMDKIYEYEGRTTPHPAVWHATLKKMLEDGAQALVAEVSSHALDQKRIWATHFHIV
GFTNLSHDHLDYHKSMEEYFKAKLRLFKEYTYEYAVVNSDDEYGKRIVRELKGRAITYGR
EGDFKILDFDTGFEGSKLKVAYEGKTYKFYSNLVGDFQAYNLALGILCCMLVGIEVQAIE
EGLKKVYVPGRFETYRGDGFLVIVDYAHTPDALENVLKSIRRLSTGRVITLFGAGGNRDR
TKRPIMGSVAEKWSDLLVITSDNPRDEDPMDIIRDILQGVKDTSKVLVEEDRKKAIKMAI
SLAEEGDTVLIAGKGHEDYQEIKGVKYPFKDSDVVKEVLSVRL
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgaagctttttgaagatgtcaaaggcattaccgataactccaaagaggtgaaggaaggt
tatatattcgtagctataaagggttctcaaaatgatggacataactttgtaaaagaagcg
ctcagcagaggtgccaagtgggtgctggtggaaaaggatgtaggcataacagataacagg
atcgtaaaagtaaaagacactcgggaagctcttggagagcttgtcagtgccttttacgga
aagccttccaagaagctcaaagttataggcataacaggcaccaacggtaagactaccacc
actcacatagtggaagcattgcttaacgcaggtggtataaaaactggtcttgtaggcact
atatactacaggctcatggacaagatatacgagtatgagggtagaacaactccacaccct
gctgtgtggcatgcaacgcttaaaaaaatgctcgaagacggtgcgcaggctctggtggca
gaggtatcatctcatgctcttgatcagaagagaatctgggcaacgcactttcacatagtg
ggctttacaaatctatctcacgaccaccttgattatcacaaaagcatggaggaatacttt
aaagcaaagctaagactcttcaaagagtacacttacgagtatgcagttgtgaattctgac
gatgagtatggaaagaggatagtaagggagctcaaaggcagagctataacttatggaagg
gaaggagattttaagatactggattttgacaccggctttgaagggtcaaaactgaaagta
gcgtatgagggaaaaacttacaaattttactctaacttagttggagactttcaggcatac
aatctggcgcttggtattttgtgttgcatgcttgttgggatagaggtgcaagccattgag
gaaggtctaaaaaaggtttatgtaccgggaaggtttgaaacatacaggggagatgggttt
ttagttattgtggattatgcacacacgcctgacgcccttgaaaatgtgctaaaaagtata
agaaggctctctacggggagggttataaccctctttggtgcaggaggcaacagagacaga
acaaaaagacccatcatgggaagcgttgcagaaaagtggtcagaccttctggttatcaca
tctgacaatcccagagacgaggaccccatggacataataagggatatacttcaaggagta
aaagacacctccaaggtgcttgtagaggaagacaggaaaaaagccataaaaatggccata
agccttgcagaggaaggtgatacagttctcattgcaggtaaaggacacgaggactatcag
gagataaaaggtgttaaatacccctttaaggactcagatgtggtgaaggaggttttgagt
gtgcgactttga

DBGET integrated database retrieval system