KEGG   Hydrogenobacter thermophilus: Hydth_1278Help
Entry
Hydth_1278        CDS       T02106                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
hte  Hydrogenobacter thermophilus
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:hte00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1171063..1171608
Genome map
AA seq 181 aa AA seqDB search
MVYYQMRKLQLIGRLLFEEGLVDARAGNLSVRIGDKMLITRRGSFLGDLKDHDFILLDIK
RESLLDERASSELVVHREVYLKTQKRAVVHAHPVSAVKLSFEKDLIVPKDSEGKELLGSV
RVLKELPSGSYQLAQAVAETLAGEKLVVVRGHGVFSADTDVFYAYSHISVLEHSCKILLD
E
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atggtctactaccagatgaggaagctccagctaattggcaggctactctttgaggagggg
cttgtggatgcaagagctggaaatctatctgtcaggataggtgataagatgctcataacc
aggaggggatctttcttgggagacctcaaagaccacgactttatactcttggacattaaa
agggaaagccttcttgatgagagggcatcttctgagcttgtggtccacagggaggtttat
ttaaaaacacaaaaacgtgccgtagttcatgcacatcctgtgagcgcagtaaagctctct
tttgaaaaagaccttatagtgccaaaagattcggaagggaaggagcttttgggaagcgtt
agggtgcttaaagagctgccttcgggaagctaccagctggctcaagcggtggcagagact
ttagctggggagaagttggtggtagttaggggacacggggttttcagtgcggacacagat
gtcttttatgcttacagtcatatatctgtccttgagcattcgtgtaaaatactgcttgat
gaatga

DBGET integrated database retrieval system