KEGG   Hydrogenobacter thermophilus: Hydth_1278Help
Entry
Hydth_1278        CDS       T02106                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
hte  Hydrogenobacter thermophilus
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hte00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Hydth_1278
Enzymes [BR:hte01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Hydth_1278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1171063..1171608
Genome map
AA seq 181 aa AA seqDB search
MVYYQMRKLQLIGRLLFEEGLVDARAGNLSVRIGDKMLITRRGSFLGDLKDHDFILLDIK
RESLLDERASSELVVHREVYLKTQKRAVVHAHPVSAVKLSFEKDLIVPKDSEGKELLGSV
RVLKELPSGSYQLAQAVAETLAGEKLVVVRGHGVFSADTDVFYAYSHISVLEHSCKILLD
E
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atggtctactaccagatgaggaagctccagctaattggcaggctactctttgaggagggg
cttgtggatgcaagagctggaaatctatctgtcaggataggtgataagatgctcataacc
aggaggggatctttcttgggagacctcaaagaccacgactttatactcttggacattaaa
agggaaagccttcttgatgagagggcatcttctgagcttgtggtccacagggaggtttat
ttaaaaacacaaaaacgtgccgtagttcatgcacatcctgtgagcgcagtaaagctctct
tttgaaaaagaccttatagtgccaaaagattcggaagggaaggagcttttgggaagcgtt
agggtgcttaaagagctgccttcgggaagctaccagctggctcaagcggtggcagagact
ttagctggggagaagttggtggtagttaggggacacggggttttcagtgcggacacagat
gtcttttatgcttacagtcatatatctgtccttgagcattcgtgtaaaatactgcttgat
gaatga

DBGET integrated database retrieval system