KEGG   Hydrogenobacter thermophilus: Hydth_1483Help
Entry
Hydth_1483        CDS       T02106                                 

Definition
Dihydrolipoyllysine-residue acetyltransferase (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
hte  Hydrogenobacter thermophilus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hte00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hydth_1483
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hydth_1483
   00020 Citrate cycle (TCA cycle)
    Hydth_1483
   00620 Pyruvate metabolism
    Hydth_1483
Enzymes [BR:hte01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Hydth_1483
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1360699..1361943
Genome map
AA seq 414 aa AA seqDB search
MDYEVVMPQFSDTMERGKVVRWLKKEGDYVEKGEVLAEIEAEKAVMELQSFRSGILKKIT
VNEGEEVPVKTTIAIIELTEKRPVVEKPQEIKKPEEKPVEKVVEKKVEEIKPVERIELPP
GLASAYAKVLASQYGIDLQELQKEGRLPSPAHEKDIMELLSERYFTPKALETLRDYHLDP
KRLVEFFKGEKITEDMLLEYIEEFNIPKRVPISSVQKSLIANLTRSIKHPHFRIYETFDL
SLIPWDKDITLTHWLIKIVGDAMMYFDRLRATVEEDHYLITPNADVGVAISVDDELYAPV
IRKVNKKSLLEIAKEARELREKAQAGKLTLEDVKGGTLTISNMGMFGIASFDAVIPYGQV
CIVSVGALDENGRASINFTFDHRVVNGTHGALFVKHLKEKVLDRNYIKSLKRGL
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggattatgaggtggtgatgcctcaattttcggatactatggagagggggaaagtggtg
cgctggctcaaaaaggagggcgattatgtagaaaagggtgaggttttggctgagatagag
gcagagaaggcagttatggagctccaatccttcagaagcggtatcctcaaaaagatcact
gtaaatgagggcgaagaagttcctgtaaaaaccaccatagccatcatagagttgacggaa
aaaagaccggtggtagaaaagccacaagaaataaaaaaacctgaggaaaaacctgtggag
aaggtggtagagaaaaaagtggaggaaattaaaccggtggagagaattgagctaccacct
ggtctcgcatccgcttatgctaaagtgttggcttcccagtatggcatagacctacaggaa
cttcaaaaggagggaaggctgccatcacccgctcatgagaaagatataatggagcttctg
agtgaaaggtactttacgccaaaggcactggaaactttaagggattaccatctggacccc
aaaagacttgtggagtttttcaaaggtgagaagataacagaggacatgcttttggaatac
attgaggagtttaacataccaaagagagtccccatatcaagcgtccaaaaaagccttata
gcaaacctcacgagaagtataaagcatccccactttaggatatacgaaacctttgacctg
tctctaataccttgggataaggacataactcttacccactggcttataaagatagtgggt
gatgccatgatgtactttgataggttgagggcaacagttgaagaagatcactatcttata
acacccaatgcggatgttggagttgccatatctgtagatgatgagctttatgctcccgtt
ataaggaaggtaaataagaagagccttttggagatagctaaggaggcaagggagctaagg
gaaaaggctcaggcaggtaagctaacccttgaagatgtaaaaggcgggacgctgactata
tccaacatgggtatgtttggaatagcttcctttgatgcagtgataccttacggtcaggta
tgtatagtgtccgttggtgcgctggacgagaacggcagggcaagtataaacttcactttt
gaccacagggtagtcaacggtacgcatggagcgctttttgtaaagcacttaaaagaaaag
gtgcttgacaggaattacataaagtctctaaagcgaggtttgtag

DBGET integrated database retrieval system