KEGG   Hydrogenobacter thermophilus: Hydth_1519Help
Entry
Hydth_1519        CDS       T02106                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
hte  Hydrogenobacter thermophilus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:hte00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Hydth_1519
DNA repair and recombination proteins [BR:hte03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Hydth_1519
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1395698..1396306)
Genome map
AA seq 202 aa AA seqDB search
MAFEDVFPKAMKEAIESIIKIPTYGERGASRFIYNLLKLPQEERIIIVNTLQNLAQSIKK
CAECGLLTDREVCSICSDEKRSKKFICIVEESQDAYAIERLERYTGVYHVLGGRIAPLEG
ISPQDLSIDSLIQRIERYKPKEVIVATNPNVEGEATANYLIKLLKRRFPNLKITRMSYGL
QFGTLIEFADELSLEKSIENRK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
ttggcttttgaagatgtcttcccaaaagctatgaaggaagcaatagaaagcattatcaag
atacccacctacggtgagagaggtgcaagcaggtttatttacaaccttcttaagctccca
caggaggaaaggatcatcatagtgaatactttacaaaatttggcgcaaagcattaaaaag
tgtgccgaatgcggactgctcaccgatagagaagtatgttccatatgctctgatgaaaag
cgaagcaaaaagttcatttgcatcgttgaagaatctcaggacgcttacgccatagaaaga
ctggaaaggtatacgggtgtgtatcatgtcttgggtggcaggatagcaccgctggagggc
atatctccacaggaccttagcattgatagcttaatacaaagaatagagaggtacaaaccc
aaagaggtcatagtagcaacaaatcccaatgtggagggtgaggcaacagccaattacctt
ataaagctcctcaagagaagatttccaaatctcaagataacgagaatgtcttacggactg
cagtttgggaccctcatagagtttgcggacgagctatccttagaaaagtccatagaaaac
agaaagtga

DBGET integrated database retrieval system