KEGG   Hydrogenobacter thermophilus: Hydth_1546Help
Entry
Hydth_1546        CDS       T02106                                 

Definition
hypothetical protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
hte  Hydrogenobacter thermophilus
Brite
Enzymes [BR:hte01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Hydth_1546
Secretion system [BR:hte02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Hydth_1546
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1421285..1421782)
Genome map
AA seq 165 aa AA seqDB search
MLMLVLVFLLLIPAFGGDLYSEFVREQVKEIPLSKAIVVGNGNNKLITFINPDCPHCRKE
WEELKPHLNRIKIYVFLFPFKTAPESYPKAFYIACSKNKLKALDEVLSGKLDGNPPKVKE
CPLVYEHINIAQKLGVRSTPYNIVLKEYKIIEGYNPELLKLLGVR
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgcttatgcttgtattggtatttttgcttttaatacctgcctttggaggagacttatac
tcggaatttgtaagggagcaggtgaaagaaatacccttaagtaaagccatagttgtggga
aatggaaataataagctcataacctttataaatccagactgtcctcattgtaggaaagag
tgggaggagctaaaaccccaccttaataggatcaagatttatgtattcctgtttcccttc
aaaacagctcccgaaagctatcccaaagccttttatatagcatgctcaaagaataagcta
aaagcccttgatgaggtgctatcgggcaagttggatggcaatccacctaaggtaaaggag
tgtccattagtatacgaacatataaacatagcgcaaaaactcggcgttaggtcaacacct
tataacatagtgctaaaagaatacaaaatcatagagggatacaatcctgagcttcttaaa
ctccttggtgtaagatga

DBGET integrated database retrieval system