KEGG   Hydrogenobacter thermophilus: Hydth_1553Help
Entry
Hydth_1553        CDS       T02106                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
hte  Hydrogenobacter thermophilus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hte00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Hydth_1553
Enzymes [BR:hte01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Hydth_1553
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1427447..1428772
Genome map
AA seq 441 aa AA seqDB search
MIDVAVVGAGISGLSIAYHLKKAGLEVKVFEKEDAVGGNIQTAYIDGYVCELGPQTILAD
SKVEEFLKDAGIKPIYANPSSKKRYIYRKGKLVALPLSPVEFLLSPFLSLGGKLRVLKEP
FVPRSPKQEESIAEFVRRRFGREFLDYVVAPFVSGVYAGDPEELSVKYAVRKVYELEQKY
GSVIKGAIKLKALGPSGKLISFEGGNATLIRKLSESLEVHKENVVLRIRRKDDIFILDTK
EGKVTAKAVVVSTPATSTGYLLRDLSWSISEEFDKIYYAPVLVVHVAVKFGVLPEGFGFL
VPKKENKRILGVIFSSNLFEGRSPEGKSLITVYIGGATDPEIIEYEDEAIVSVLERELRE
TVDIRDWDLLKITRWKKGIPQYTVGYGRYLELANSIEMEQPGLFLSGNYLYGVSVADCIR
VSHHIAKRVIDFLEVKGRTVV
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgatagatgtagcggtagtaggggcaggtatatccgggctatccatagcctatcacctt
aaaaaggctggacttgaggtaaaggtttttgaaaaagaagatgccgtaggtggaaacata
caaacagcatacatagacggttatgtttgcgagcttggacctcagaccattcttgcggac
agtaaagtagaagagtttttaaaagatgcaggtataaagcccatatatgccaatccttct
tccaaaaagagatacatatacaggaagggtaagttggtggctcttcctctatcacccgta
gaatttctcttatcaccttttctgtccctcggcggaaagctaagagtcctcaaagagcct
tttgttccaaggtctcccaagcaggaagaaagtatagcggagtttgtcagaaggcgtttt
gggagggagtttttagattatgtagtagctcctttcgtgtctggagtttacgctggagac
ccagaggagctatctgttaaatacgcagttagaaaggtttacgagctggagcaaaagtac
ggaagcgttataaagggagccataaagctcaaagctcttggtccatcgggaaagctcata
tcctttgaaggaggaaatgcaactcttataagaaagctctctgaaagtttagaggttcat
aaagagaatgtggttctgaggataaggagaaaggacgatatttttatcctagataccaag
gaggggaaggttacggctaaggcggttgtagtttctactcctgccacatctacaggttat
ctgctcagggatctgtcttggagcatatccgaggagtttgacaaaatatactacgctcct
gttctggtggtgcatgtggcagtaaagtttggtgttctgccagaaggctttggtttttta
gtgccaaaaaaggaaaacaaaaggatactgggggtgatcttttcatctaatctttttgaa
ggaaggagtccagagggcaagagtcttatcaccgtatatattggtggtgccacagaccca
gaaataatagaatacgaagatgaagccattgtaagtgtgctggagagggaactaagagag
accgtagatataagagactgggatcttttaaaaataacgcgctggaaaaagggtataccc
caatacactgtggggtacggaaggtatcttgagctggcaaactccatagagatggagcaa
cccggacttttcttgagtggcaattatctttatggtgtttccgttgcagactgtataaga
gtttcacatcacatagcaaagagggtaatagactttttggaagttaaggggcgtactgtt
gtataa

DBGET integrated database retrieval system