KEGG   Hydrogenobacter thermophilus: Hydth_1553Help
Entry
Hydth_1553        CDS       T02106                                 

Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
hte  Hydrogenobacter thermophilus
Pathway
hte00860  Porphyrin and chlorophyll metabolism
hte01100  Metabolic pathways
hte01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hte00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Hydth_1553
Enzymes [BR:hte01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Hydth_1553
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     Hydth_1553
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO FAD_binding_2 Pyr_redox_3 Thi4 Pyr_redox_2 HI0933_like NAD_binding_9 Pyr_redox FAD_binding_3 3HCDH_N Lycopene_cycl FAD_oxidored ApbA GIDA FMO-like NAD_Gly3P_dh_N TrkA_N NAD_binding_2 AlaDh_PNT_C K_oxygenase MCRA
Motif
Other DBs
NCBI-ProteinID: ADO45937
UniProt: D3DJL2
Position
1427447..1428772
Genome map
AA seq 441 aa AA seqDB search
MIDVAVVGAGISGLSIAYHLKKAGLEVKVFEKEDAVGGNIQTAYIDGYVCELGPQTILAD
SKVEEFLKDAGIKPIYANPSSKKRYIYRKGKLVALPLSPVEFLLSPFLSLGGKLRVLKEP
FVPRSPKQEESIAEFVRRRFGREFLDYVVAPFVSGVYAGDPEELSVKYAVRKVYELEQKY
GSVIKGAIKLKALGPSGKLISFEGGNATLIRKLSESLEVHKENVVLRIRRKDDIFILDTK
EGKVTAKAVVVSTPATSTGYLLRDLSWSISEEFDKIYYAPVLVVHVAVKFGVLPEGFGFL
VPKKENKRILGVIFSSNLFEGRSPEGKSLITVYIGGATDPEIIEYEDEAIVSVLERELRE
TVDIRDWDLLKITRWKKGIPQYTVGYGRYLELANSIEMEQPGLFLSGNYLYGVSVADCIR
VSHHIAKRVIDFLEVKGRTVV
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgatagatgtagcggtagtaggggcaggtatatccgggctatccatagcctatcacctt
aaaaaggctggacttgaggtaaaggtttttgaaaaagaagatgccgtaggtggaaacata
caaacagcatacatagacggttatgtttgcgagcttggacctcagaccattcttgcggac
agtaaagtagaagagtttttaaaagatgcaggtataaagcccatatatgccaatccttct
tccaaaaagagatacatatacaggaagggtaagttggtggctcttcctctatcacccgta
gaatttctcttatcaccttttctgtccctcggcggaaagctaagagtcctcaaagagcct
tttgttccaaggtctcccaagcaggaagaaagtatagcggagtttgtcagaaggcgtttt
gggagggagtttttagattatgtagtagctcctttcgtgtctggagtttacgctggagac
ccagaggagctatctgttaaatacgcagttagaaaggtttacgagctggagcaaaagtac
ggaagcgttataaagggagccataaagctcaaagctcttggtccatcgggaaagctcata
tcctttgaaggaggaaatgcaactcttataagaaagctctctgaaagtttagaggttcat
aaagagaatgtggttctgaggataaggagaaaggacgatatttttatcctagataccaag
gaggggaaggttacggctaaggcggttgtagtttctactcctgccacatctacaggttat
ctgctcagggatctgtcttggagcatatccgaggagtttgacaaaatatactacgctcct
gttctggtggtgcatgtggcagtaaagtttggtgttctgccagaaggctttggtttttta
gtgccaaaaaaggaaaacaaaaggatactgggggtgatcttttcatctaatctttttgaa
ggaaggagtccagagggcaagagtcttatcaccgtatatattggtggtgccacagaccca
gaaataatagaatacgaagatgaagccattgtaagtgtgctggagagggaactaagagag
accgtagatataagagactgggatcttttaaaaataacgcgctggaaaaagggtataccc
caatacactgtggggtacggaaggtatcttgagctggcaaactccatagagatggagcaa
cccggacttttcttgagtggcaattatctttatggtgtttccgttgcagactgtataaga
gtttcacatcacatagcaaagagggtaatagactttttggaagttaaggggcgtactgtt
gtataa

DBGET integrated database retrieval system